KEGG   Maricaulis maris: Mmar10_2498Help
Entry
Mmar10_2498       CDS       T00394                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmr  Maricaulis maris
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmar10_2498
   01230 Biosynthesis of amino acids
    Mmar10_2498
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmar10_2498
  Energy metabolism
   00680 Methane metabolism
    Mmar10_2498
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmar10_2498
Enzymes [BR:mmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mmar10_2498
Exosome [BR:mmr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mmar10_2498
  Exosomal proteins of melanoma cells
   Mmar10_2498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2720098..2720829
Genome map
AA seq 243 aa AA seqDB search
MPQLALIRHGQSEWNLQNRFTGWVDVDLTDEGVAQARQSGELLAKAGFEPTHAFVSVLKR
AIKTLNFTLEGLDRLWIPVDKSWRLNERHYGALAGLDKNETRAKHGDEQVKIWRRSFDTP
PPPVATDHAYHPLNDHRYADVPRELLPASESLKSTLDRVEPYWSSSIQPRLAAGETLIVA
AHGNSLRALVKLLFKVSDPDIMEVEVPTGNPLLIDLEDDGITLRSARYLDPVRAKPLPPL
PGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctcgcacttatccggcacggccagagcgaatggaacctccagaaccggttc
accggatgggttgatgtggatctgaccgatgaaggggttgcccaggcgcggcagtccggc
gagctgctggcgaaggccggtttcgagcccacccacgcctttgtgtctgtgctgaagcgt
gccatcaagaccctcaacttcaccctggaaggtctggatcggctgtggataccggtcgac
aaatcctggcggctgaacgaacgccattatggcgctcttgccggtctcgacaaaaacgaa
acccgggccaagcatggcgatgaacaggtgaaaatctggcgccgctccttcgacacaccg
cccccgcccgtcgccaccgatcacgcctaccatccgctcaatgatcaccgttatgccgat
gtgccgcgcgaactccttccggcatcggaatccctgaagtcaacactggaccgggtcgag
ccatactggtcctcgtcgatccaaccccggcttgcggccggcgagaccctgatcgtggct
gctcacggcaacagtttgcgcgccctggtaaaactccttttcaaggtctccgatccggac
atcatggaagtcgaggtgccgacaggaaatccactcctcatcgacctcgaagacgacggc
atcaccttgcggtctgcgcgatatcttgatccggttcgcgccaagcccctgccaccactt
ccgggcgcatga

DBGET integrated database retrieval system