KEGG   Maricaulis maris: Mmar10_2498Help
Entry
Mmar10_2498       CDS       T00394                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmr  Maricaulis maris
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmar10_2498
   01230 Biosynthesis of amino acids
    Mmar10_2498
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmar10_2498
  Energy metabolism
   00680 Methane metabolism
    Mmar10_2498
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmar10_2498
Enzymes [BR:mmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mmar10_2498
Exosome [BR:mmr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mmar10_2498
  Exosomal proteins of melanoma cells
   Mmar10_2498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2720098..2720829
Genome map
AA seq 243 aa AA seqDB search
MPQLALIRHGQSEWNLQNRFTGWVDVDLTDEGVAQARQSGELLAKAGFEPTHAFVSVLKR
AIKTLNFTLEGLDRLWIPVDKSWRLNERHYGALAGLDKNETRAKHGDEQVKIWRRSFDTP
PPPVATDHAYHPLNDHRYADVPRELLPASESLKSTLDRVEPYWSSSIQPRLAAGETLIVA
AHGNSLRALVKLLFKVSDPDIMEVEVPTGNPLLIDLEDDGITLRSARYLDPVRAKPLPPL
PGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctcgcacttatccggcacggccagagcgaatggaacctccagaaccggttc
accggatgggttgatgtggatctgaccgatgaaggggttgcccaggcgcggcagtccggc
gagctgctggcgaaggccggtttcgagcccacccacgcctttgtgtctgtgctgaagcgt
gccatcaagaccctcaacttcaccctggaaggtctggatcggctgtggataccggtcgac
aaatcctggcggctgaacgaacgccattatggcgctcttgccggtctcgacaaaaacgaa
acccgggccaagcatggcgatgaacaggtgaaaatctggcgccgctccttcgacacaccg
cccccgcccgtcgccaccgatcacgcctaccatccgctcaatgatcaccgttatgccgat
gtgccgcgcgaactccttccggcatcggaatccctgaagtcaacactggaccgggtcgag
ccatactggtcctcgtcgatccaaccccggcttgcggccggcgagaccctgatcgtggct
gctcacggcaacagtttgcgcgccctggtaaaactccttttcaaggtctccgatccggac
atcatggaagtcgaggtgccgacaggaaatccactcctcatcgacctcgaagacgacggc
atcaccttgcggtctgcgcgatatcttgatccggttcgcgccaagcccctgccaccactt
ccgggcgcatga

DBGET integrated database retrieval system