KEGG   Maricaulis maris: Mmar10_2790Help
Entry
Mmar10_2790       CDS       T00394                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mmr  Maricaulis maris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmar10_2790
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mmar10_2790
Enzymes [BR:mmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mmar10_2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3077930..3079051
Genome map
AA seq 373 aa AA seqDB search
MMRPGFDAARCIVVKVGSSLLQAGDAVIAAIVSDIVALRGRGRRIILVSSGAVALGRTRL
GLPAGDLSLEQKQAAAAVGQPLLVGLWESAFATHQTVTAQALLTLDVTENRRSWLNARAT
LSTLLDLGAIPIVNENDTIATDEIRYGDNDRLAARVAQLVGADLLVLLSDIDGLHEADPR
LAPDAPAIHDIDVIDDRIRAMAGDAGTGVGTGGMRTKILAAELAGGSGCATAITLGSADT
PLLALARPDHGSWFHPAGTSANARKRWISGVVSRNGAVRIDDGAASALVQGKSLLPVGVQ
SVEGQFERGETIRILGQDGRLIARGVTAYNADDARLIAGCRSDLAGRRLGYRRSAALVHA
DDIVVAGTAGDER
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgacccggcttcgacgcggcacgctgcatcgtggtcaaggtcggctccagcctc
ttgcaggcaggcgacgccgtgatcgctgccatcgtgtccgacatcgttgccctacgtggc
cgcggcaggcggatcattcttgtctcctcaggcgccgtcgcccttggtcggacccggctc
ggactgcccgcgggtgatctgagccttgagcaaaaacaggccgccgctgcggtcgggcaa
ccgctgctggtcgggctttgggagagcgcctttgcaacccaccaaacagtaaccgcccag
gcccttctaacactcgacgtgaccgagaaccggcgcagctggctcaatgcgcgcgcgacc
ctttcgaccctgcttgatctcggcgcgataccgatcgtcaacgagaacgacaccatcgcc
actgatgagatccgctacggtgacaatgaccggcttgcagcccgggttgctcaactggtc
ggcgccgacctgctggttctgcttagcgatatcgacggtctgcatgaagccgatccccga
ctggctcctgacgccccggccattcacgacatcgacgtgatcgacgaccggatccgggcg
atggccggcgacgccggcactggcgtgggcacaggcgggatgcgaaccaagattctggcc
gctgaactggctggcggatcaggctgcgcaactgccatcacgctcggttccgccgacacg
cccctgcttgcgctggcaaggccggatcacgggtcctggttccacccggccggcacttcg
gccaatgcccgcaagcgctggatttccggcgtggtcagccgcaatggagcggtccggatt
gatgacggcgcggcctcggccctggtgcagggaaaatccttgctcccggtcggcgtccaa
tccgtcgaaggtcagttcgagcgtggcgagaccattcgaattctggggcaggacgggcgt
ttgatcgcccgcggcgtcaccgcctacaatgccgacgatgcccgcctgattgccggttgc
cgaagcgacctggccggaaggcggctcggctatcgccgcagtgccgccctggttcacgcc
gacgacatcgtagtggcggggacagcgggggatgaacgatga

DBGET integrated database retrieval system