KEGG   Maricaulis maris: Mmar10_2816Help
Entry
Mmar10_2816       CDS       T00394                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmr  Maricaulis maris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmar10_2816
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmar10_2816
  Amino acid metabolism
   00310 Lysine degradation
    Mmar10_2816
Enzymes [BR:mmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mmar10_2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3101862..3103385)
Genome map
AA seq 507 aa AA seqDB search
MTDITVPQLGESVTEATVGSWMVKTGDAVSRDDVLVELETDKVAVEVRAEADGVMGEIFA
AEGDNVEIGAKLAVIEAAGSDAAAKSEPAEDSSDPAPMAAAEPDVKESKAAGSAETVEAT
VPQMGESVTEGTIGAWLVKAGDSVEIDQALVEIETDKVAVEVPSPVAGVVSELLVAEGDT
VAPGDAVARIGEGGAAQAAPSAESQPSEGSTDTKTMPSAARVIEENRLDAGAITGSGKDG
RITKGDALKAAAGAPAAPKAAPAAAAAPVAPRETGPREERVRMTRLRQTIAKRLKDAQNA
AAILTTYNEADMSAIMAARKAHQEAFVAKHGVKLGFMSFFVKACCHALKEVPAVNAEIDG
TDIIYKNYYDMGVAVGTDRGLVVPVVRDADQMTLAEIEKEIIRLGKRARDGKLSIDEMQG
ATFTISNGGVYGSLMSMPILNAPQSGILGMHKIQERPMAENGQVVIKPMMYLALSYDHRI
VDGKEAVTYLVRVKENLEDPQRMMFDL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcaccgtgccgcagctcggcgagagcgtcaccgaagccaccgtgggcagc
tggatggtcaagaccggcgacgcggtctcccgggatgatgtcctggttgagttggaaacc
gacaaggtcgctgttgaagtccgtgctgaagcggacggagtgatgggtgagattttcgcc
gccgaaggcgacaatgttgaaattggcgccaagctggctgtgatcgaagctgctggcagt
gatgcagcagccaagagcgaaccggctgaagacagcagtgatccggcaccgatggccgct
gcggaaccggacgtcaaagagtccaaagccgccggctcggctgagaccgtcgaagccacc
gtgccgcagatgggtgaaagcgtaaccgagggaacaatcggagcctggctcgtgaaagcc
ggtgactcggtggagatcgaccaggcgctggtcgagatcgaaaccgacaaggtggcggtt
gaagttccgtctcccgttgctggtgttgtctccgagctgttggtagccgagggcgacacg
gttgcgcctggcgatgcggtcgcccgcattggcgaggggggcgccgcccaagcagcgccg
agcgctgaaagccagccgtccgagggctcgacagacacaaagaccatgccgtctgccgcc
cgggtcatcgaagagaacaggctggatgctggtgcgatcaccggatcgggcaaggacggc
cgcattaccaagggtgacgcattgaaggctgctgctggtgcgccggctgcgccaaaagcc
gctccggcggctgccgccgcgccggtcgctccccgcgagacgggaccacgcgaagaacgg
gtccgtatgacccgcctgcgccagacaatcgccaagcggctcaaggatgcccagaacgcc
gctgccatcctgaccacctataatgaagccgacatgtcggcgatcatggcggcccgaaag
gcgcaccaggaggccttcgtggccaagcatggcgtcaagctgggcttcatgagcttcttc
gtgaaggcttgttgccacgcgctgaaggaagtgccggcggtcaatgccgaaatcgacggc
accgacatcatctacaagaattactatgacatgggtgtcgcagtcggcaccgatcgcggc
ctggtcgtaccggtcgtgcgtgacgccgaccagatgaccctggcggagatcgagaaagag
atcatccggctgggcaagcgggcgcgtgacggcaagctttcgatcgacgaaatgcagggc
gcgaccttcaccatctcgaatggcggcgtgtacggctcgctgatgtcgatgccgatcctc
aatgcgcctcagtcaggcattctgggtatgcacaagatccaggaacgcccgatggccgag
aatggtcaggttgtcatcaaacccatgatgtaccttgctctttcgtacgatcaccgaatt
gtcgacggcaaggaagcggttacctacctcgtgcgggtaaaggaaaacctggaagatcca
caacgcatgatgttcgacctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system