KEGG   Maricaulis maris: Mmar10_2836Help
Entry
Mmar10_2836       CDS       T00394                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmr  Maricaulis maris
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mmar10_2836
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmar10_2836
  Lipid metabolism
   00071 Fatty acid degradation
    Mmar10_2836
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mmar10_2836
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mmar10_2836
   00626 Naphthalene degradation
    Mmar10_2836
Enzymes [BR:mmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mmar10_2836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3122249..3123391)
Genome map
AA seq 380 aa AA seqDB search
MATFQFRTVPHIHAGRGSATELATIAAPLLAGVERVVLVTDRGVRQAGLIDAPLGELEVA
GLSVLVLDEVIADPPEDMVLAATARARDFGAQLVIGFGGGSSLDTAKLVALLLGSDQPLS
DMYGVNKVRGQRLPLILIPTTAGTGSEVTPISVVTVGETSKMGVNDPALYGDLAVLDAAL
TLGLPRHVTAATGIDAMVHAIEAYTSAIEKNPVSDALALAGLKKLHGSIERACLDGADME
AREDMLLGALLAGQAFANAPVGAVHALAYPLGGIFHVPHGLSNSLMLPPVLRYNAPSAEP
LYTQLAAHLDLAGASTEALVTEMERIAGVVGIETRLSQVGVSHNDLPKMAEDAMKVERLL
KNNPRPMTLEAAHACYESVL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggccacattccagttccgaaccgttccccatattcacgccggtcgcggttccgcgacc
gaattggcaaccatagccgcccccctcctggccggggtcgagcgtgtcgtcctggtcact
gaccggggcgtgcgacaggccggcctgattgatgccccacttggcgagctggaggttgcg
ggtctgtctgtgctcgtcctggacgaggtgatcgccgatccgcctgaagacatggtgttg
gcggcgaccgcaagggcgcgcgattttggcgcccaattggtgattggctttggcggtggg
tcgtcactggatacagccaagctggtcgccttgctgctgggcagtgaccagcccctgtcc
gacatgtatggcgtcaacaaggttcggggtcagagactgccgctcatcctgatcccgacg
accgcgggcaccgggtcggaggtcacaccgatttctgtcgtgaccgtcggcgaaacgtcg
aaaatgggggtcaatgatccggccctgtatggcgatctggctgtcctcgatgcggctttg
acgctcggtctgcctcgccatgtcacggcggcgaccgggatcgacgccatggtgcatgcc
atcgaggcctatacctcggcgatcgagaaaaatccggtatctgatgctctggccttggcc
ggtttgaagaaactgcacggatcgatcgaacgggcctgcctcgacggggccgacatggag
gcccgcgaggacatgctgctgggcgcgctgctggctggccaggcctttgccaacgccccg
gtgggcgccgtccatgcgctggcctacccgctcggcgggatattccatgtgccgcacggg
ctctccaactcgctgatgttgccgccagtccttcgctacaatgcacccagcgccgagccg
ctttacacgcagctggcagcgcatctcgatctcgccggagcctcgaccgaagccttggtc
accgaaatggagcgcattgcaggcgtcgtcgggatcgaaactcgtctgagccaggtcggt
gtctcccataatgacctgccaaaaatggccgaggacgccatgaaggtggagcgccttttg
aagaataatccgcgaccgatgacgctggaagccgcccacgcttgttatgagtcggtgctg
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system