KEGG   Maricaulis maris: Mmar10_3076Help
Entry
Mmar10_3076       CDS       T00394                                 

Definition
formamidopyrimidine-DNA glycosylase / DNA-(apurinic or apyrimidinic site) lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mmr  Maricaulis maris
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mmr03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3365140..3366003
Genome map
AA seq 287 aa AA seqDB search
MPELPEVETVRRGLVPALEGRRILAVDVNRPNLRYPFPERFAARLAGRRVEAIDRRAKYL
LFRLDSGETMIGHLGMSGRFSIEVEGEVAQPGDFVHAAPANPKHDHVVFRAEGGVVVRYN
DPRRFGYMELFPTADEASHKTLGALGPEPHGNEFSGAYLGEVLAGRRTPIKTALLDQSIV
AGLGNIYVCEALHRSGISPRRVSASIPGARAERLARDVRDVIVEAIEAGGSSLKDFASTD
GALGYFQHGFRVYDRLGAPCPTPGCVGEIQRLVQSGRSTWFCSSCQR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcctgaagtagagacggttcgccggggcctggtgccggcattggagggg
cggcgcattctcgccgtggacgtcaatcgtcccaatttgcgctacccgtttccggagcga
tttgcagcgcggctggccggccgtcgggtcgaggcaatcgacaggcgggccaaatatctt
ctgttccggctcgacagcggcgaaacgatgatcgggcatctgggcatgtccgggcggttc
tcgatcgaggttgagggtgaggtggcccagcccggtgatttcgtccatgccgcccccgcg
aaccccaagcatgatcatgtcgtgttccgggccgagggtggcgtggtggtccggtataat
gacccgcgccgtttcggttacatggagctgttcccgaccgccgatgaggcgtcccacaag
acgctgggcgcgctcggacccgagccgcacggcaatgagttctcgggtgcctatcttggt
gaggtgctggccgggcgccggaccccgatcaagaccgccctgctcgaccagtcgatcgtg
gcgggcctgggcaatatctatgtgtgcgaggctctgcatcgatccggcatcagtccgcgc
cgcgtatccgccagcattcccggtgcccgtgccgagcgtctggcccgggacgtgcgcgat
gtcattgtcgaggccatcgaggccggaggctcttcgctcaaggacttcgcctcgaccgac
ggcgcgcttggttatttccagcatggcttccgtgtgtatgaccggctgggagcgccctgc
ccgacaccgggctgcgtcggcgaaatccagcggcttgtgcagtcgggtcgctcgacctgg
ttctgcagcagctgtcagcgatga

DBGET integrated database retrieval system