KEGG   Janthinobacterium sp. Marseille: mma_0013Help
Entry
mma_0013          CDS       T00561                                 

Gene name
cheB1
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:mms00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mma_0013 (cheB1)
Enzymes [BR:mms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     mma_0013 (cheB1)
Two-component system [BR:mms02022]
 CheA family
  WspE-WspRF [MD:M00509]
   mma_0013 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(18589..19599)
Genome map
AA seq 336 aa AA seqDB search
MKIGIVNDVPMVVEILRRALAEHPQHQLIWVAQDGIQAAEMCAWQLPDIVLMDIIMPNAD
GVEATRRIMQKTPCPILLVTADISANAVKVYEALGHGALDVVTTPVMTGGNFQQGAAALI
AKIEKVARMGKKVEAPVPVKKAAVVRDADPSTRLVVIGASAGGPAALAELLRGLPADFPA
AVVIVQHINPAFVDGMADWLQQQTALRVRVAKEGDQPLSGTVFIAGTNQHLLIKNRDSLG
YVQEAPTDIYHPSIDVLFHSVVQQWQGKAVGVLLTGMGRDGALGLKAMHDNKYHTIVQDQ
ESSSVYGMPKAAVALNAATDILPVSGIAQKLVNLFQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcggcatcgtcaatgacgtacccatggtggttgagatattgcgcagggcgctg
gccgagcatccacagcatcaactcatctgggtcgcacaagacggtatacaggcggcggaa
atgtgtgcgtggcagctgcccgatatcgtactgatggatatcatcatgccgaatgcagac
ggcgtggaagcaacgcgtcgcatcatgcaaaagacgccttgcccgatcctgctggtgaca
gcggatatcagtgcgaatgcagtcaaggtgtatgaagcgcttggacacggcgcgctggat
gtggtgacaacgcccgtcatgaccggtggtaatttccagcagggcgccgcagcactgatc
gcaaaaatagaaaaagttgcgcgcatgggcaagaaggtcgaagccccggtgccggtgaag
aaagcagcggtagtgcgggacgccgatccctccaccagattggtggtaataggcgcatcc
gccggtggcccggcggcattggccgaattgttgcgcggcttgccggcagacttcccggca
gcagtcgttatcgtgcagcacatcaatccggccttcgtcgatggcatggccgattggctg
caacaacaaaccgccttgcgggtgcgtgtggcgaaggaaggcgatcagccattgagcgga
acggtcttcatcgccggaaccaatcaacatctgttgatcaagaaccgcgacagcctgggc
tatgtacaggaagcgccgaccgatatctatcatccgtctatcgacgtactgtttcacagc
gtagtacaacaatggcagggcaaggcagtgggagtactgctgaccggcatggggcgcgat
ggcgcgctcggcctgaaagcgatgcacgacaataaatatcacaccatcgtgcaagaccag
gaaagcagttccgtatacggtatgccgaaagcagccgtcgcactcaatgcggcgaccgac
attctccccgtatccggcattgcacaaaaattagtcaatctgtttcaatga

DBGET integrated database retrieval system