KEGG   Janthinobacterium sp. Marseille: mma_0230Help
Entry
mma_0230          CDS       T00561                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mms  Janthinobacterium sp. Marseille
Brite
Enzymes [BR:mms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     mma_0230 (dsbC)
Secretion system [BR:mms02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   mma_0230 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248160..248882
Genome map
AA seq 240 aa AA seqDB search
MKLIKAAAAALLGLAFVSAFAETAQEAAVRKAIEPRLGEDAKVVGVSKTPYSGLYEVQVN
GDIIYTDAKAQYLFVGRIVDTKTYQDYTKARLEEINKVAFSDLPLEAAMKQVKGNGKRVI
AVFEDPNCGYCKRFRQTLEGINDITVYTFMYNILSPDSIAKSRNVWCSADRNKAWDDWML
NGKAPAPASDKCTTPHEKVLALGQRMGVTGTPTIIFTDGSRIPGAIDAKALEAKLASIKQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaatcaaggctgccgctgcagcattgctcggcctggcttttgtttctgctttt
gccgaaaccgcacaggaagctgctgtgcgcaaggcaatcgagccgcgcctgggcgaagat
gccaaggtagtgggtgtgagcaagaccccttactcgggcctgtatgaagtccaggtcaat
ggcgacatcatctataccgatgcgaaagcgcagtatttgttcgtaggtcgtatcgttgat
accaagacctatcaggattacaccaaggcacgcctggaagaaatcaataaggtggcgttc
agcgacctgccactggaagctgcgatgaagcaggtcaagggcaatggcaagcgcgtcata
gcagtgtttgaagacccgaactgcggctattgcaaacgtttccgccagacccttgaaggt
atcaatgacatcactgtctatacctttatgtataacatcctgtcgccggactcgatcgcc
aagtcacgcaatgtctggtgttcggctgatcgcaacaaggcatgggatgactggatgctg
aatggtaaagcgccggctcctgcttccgataaatgtacgacgccgcatgaaaaggtgttg
gcgctggggcaaagaatgggtgtgaccggtacgccgacgattattttcactgacggttcg
cgtattccgggtgcgattgatgccaaggcgctggaagcaaagctggcttcgatcaagcag
taa

DBGET integrated database retrieval system