KEGG   Janthinobacterium sp. Marseille: mma_0237Help
Entry
mma_0237          CDS       T00561                                 

Gene name
rpe
Definition
D-ribulose-5-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mma_0237 (rpe)
   01230 Biosynthesis of amino acids
    mma_0237 (rpe)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    mma_0237 (rpe)
   00040 Pentose and glucuronate interconversions
    mma_0237 (rpe)
Enzymes [BR:mms01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     mma_0237 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(255765..256430)
Genome map
AA seq 221 aa AA seqDB search
MPNYRIAPSILSADFARLGEEVCNVVAAGADIIHFDVMDNHYVPNLTIGPLVCEAIRPHV
QVPIDVHLMVKPVDRIIPDFAKAGANIITFHPEASEHIDRTLQLIRDNGCKAGLVFNPAT
PLNHLEHVMDKLDIILMMSVNPGFGGQSFIPHTLKKIAAVRKMIDESGRDIMLEVDGGIK
IDNIEAAARAGADTFVAGSAIFGKPDYKAVIDAMRSELAKV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactaccgcatcgcccccagcatcctatccgccgacttcgcccgccttggcgaa
gaagtatgtaacgtcgtcgcggccggcgccgatatcatccatttcgacgtgatggacaac
cattatgttcctaatttgacaatcgggcccctggtctgtgaagcgatacgcccgcatgtg
caagtgcctatcgatgtgcacctgatggtcaagccggtagaccgcatcattcctgacttt
gccaaggctggtgccaatatcatcaccttccacccggaagcgtccgagcacatcgatcgt
acgctgcaactgatacgcgacaacggctgcaaagccggcctggttttcaatccggccacg
cctttgaaccacctggaacacgtgatggacaagctcgacatcatcctgatgatgtcggtc
aatccgggctttggcggtcaatccttcattccgcatacgctgaagaagatcgctgcagta
cgcaaaatgatcgatgaatccggccgcgacatcatgctggaagtcgatggcggcatcaaa
atcgacaatatcgaagcggctgcacgcgccggtgccgacacctttgtcgccggttccgcg
attttcggcaaaccggactacaaggcagtgatcgatgcgatgcgcagcgaactggcgaaa
gtctga

DBGET integrated database retrieval system