KEGG   Minibacterium massiliensis: mma_0237Help
Entry
mma_0237          CDS       T00561                                 

Gene name
rpe
Definition
D-ribulose-5-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mms  Minibacterium massiliensis
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:mms01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mms01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mms00030]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mms00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(255765..256430)
Genome map
AA seq 221 aa AA seqDB search
MPNYRIAPSILSADFARLGEEVCNVVAAGADIIHFDVMDNHYVPNLTIGPLVCEAIRPHV
QVPIDVHLMVKPVDRIIPDFAKAGANIITFHPEASEHIDRTLQLIRDNGCKAGLVFNPAT
PLNHLEHVMDKLDIILMMSVNPGFGGQSFIPHTLKKIAAVRKMIDESGRDIMLEVDGGIK
IDNIEAAARAGADTFVAGSAIFGKPDYKAVIDAMRSELAKV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactaccgcatcgcccccagcatcctatccgccgacttcgcccgccttggcgaa
gaagtatgtaacgtcgtcgcggccggcgccgatatcatccatttcgacgtgatggacaac
cattatgttcctaatttgacaatcgggcccctggtctgtgaagcgatacgcccgcatgtg
caagtgcctatcgatgtgcacctgatggtcaagccggtagaccgcatcattcctgacttt
gccaaggctggtgccaatatcatcaccttccacccggaagcgtccgagcacatcgatcgt
acgctgcaactgatacgcgacaacggctgcaaagccggcctggttttcaatccggccacg
cctttgaaccacctggaacacgtgatggacaagctcgacatcatcctgatgatgtcggtc
aatccgggctttggcggtcaatccttcattccgcatacgctgaagaagatcgctgcagta
cgcaaaatgatcgatgaatccggccgcgacatcatgctggaagtcgatggcggcatcaaa
atcgacaatatcgaagcggctgcacgcgccggtgccgacacctttgtcgccggttccgcg
attttcggcaaaccggactacaaggcagtgatcgatgcgatgcgcagcgaactggcgaaa
gtctga

DBGET integrated database retrieval system