KEGG   Janthinobacterium sp. Marseille: mma_0240Help
Entry
mma_0240          CDS       T00561                                 

Gene name
paaG1
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    mma_0240 (paaG1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    mma_0240 (paaG1)
   00650 Butanoate metabolism
    mma_0240 (paaG1)
  Lipid metabolism
   00071 Fatty acid degradation
    mma_0240 (paaG1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    mma_0240 (paaG1)
   00310 Lysine degradation
    mma_0240 (paaG1)
   00360 Phenylalanine metabolism
    mma_0240 (paaG1)
   00380 Tryptophan metabolism
    mma_0240 (paaG1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    mma_0240 (paaG1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    mma_0240 (paaG1)
   00281 Geraniol degradation
    mma_0240 (paaG1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    mma_0240 (paaG1)
   00627 Aminobenzoate degradation
    mma_0240 (paaG1)
   00930 Caprolactam degradation
    mma_0240 (paaG1)
Enzymes [BR:mms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     mma_0240 (paaG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
258376..259152
Genome map
AA seq 258 aa AA seqDB search
MQYENILVEIHGKVGVITLNRPAALNALNDKLMDELGLALQSFDGDDDIGCMIITGSEKA
FAAGADIGAMATYTYMDVYKGDYITRNWEQIRSVRKPVIAAVAGYALGGGCELAMMCDFI
IAADTAKFGQPEIKLGIIPGAGGTQRLPRAVSKSKAMDLCLTARMMDAAEAERAGLVSRV
VAADKLHEEALAAATVIANMSLPMVMMVKESINRAYETTLAEGVQFERRLFHSTFATADQ
KEGMQAFIEKRAAHFKNS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacgaaaatattctggtcgaaatccacggcaaggttggcgtgatcaccttgaat
cgccctgctgcgctgaatgcgctcaatgacaaattgatggatgagctgggtttggccctg
caatcctttgatggcgatgacgatatcggctgcatgatcattactggtagcgaaaaagcc
tttgccgccggcgccgatatcggcgcgatggcaacttatacatatatggatgtatataaa
ggcgattacatcacgcgtaactgggagcaaatccgcagcgtgcgcaaaccggtcatcgct
gcagttgctggttatgcattaggcggtggttgcgaactggcaatgatgtgcgatttcatc
attgctgcggatacggccaagttcggccaaccggaaatcaagctgggcattattcccggt
gccggcggtacacagcgcttaccgcgtgcggtatccaagtcaaaagcgatggatctgtgc
ctgactgcgcgcatgatggatgctgcggaagcagaacgtgcgggtttggtttcgcgcgta
gtggctgcagataagttgcatgaagaagcgttggcggcggcaactgttattgccaatatg
tccctgccgatggtgatgatggtcaaagagtctattaatcgtgcatacgagacgacgctg
gccgaaggtgtgcagttcgagcgccgtttattccacagcacctttgctacagcggaccag
aaggaaggaatgcaggcgtttatagagaagcgcgcggcgcatttcaagaacagttaa

DBGET integrated database retrieval system