KEGG   Janthinobacterium sp. Marseille: mma_0746Help
Entry
mma_0746          CDS       T00561                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    mma_0746
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mma_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(839739..840107)
Genome map
AA seq 122 aa AA seqDB search
MFKKLFLSLALGLLASASHAAGDVAAGKRVFAKCANCHQVGPSARGNFGPQLNGIVGRTA
GTTKDYKYSAAMSSSRVVWTEANLRAFIQSTNDVIPGNKMRFFGISDEKQITDLLAYLQT
FK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaaattattcctgtcgctggcacttggcttgctggcatccgccagccatgca
gcaggcgatgtcgctgccggcaaacgcgtgtttgcgaaatgtgcgaattgccatcaggtc
gggccttctgcccgcggcaactttggaccacagctcaacggtatagtcggacgcacagcg
ggaacgacaaaggattacaagtattctgcggcgatgagttcttcccgcgtcgtgtggacc
gaggcgaacctacgcgccttcattcaatcgacgaatgatgtgataccgggtaacaagatg
cgcttctttggcatcagcgatgaaaagcagatcacggacttgctggcttatctgcaaacc
ttcaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system