KEGG   Minibacterium massiliensis: mma_0746Help
Entry
mma_0746          CDS       T00561                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
mms  Minibacterium massiliensis
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mms00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mms02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(839739..840107)
Genome map
AA seq 122 aa AA seqDB search
MFKKLFLSLALGLLASASHAAGDVAAGKRVFAKCANCHQVGPSARGNFGPQLNGIVGRTA
GTTKDYKYSAAMSSSRVVWTEANLRAFIQSTNDVIPGNKMRFFGISDEKQITDLLAYLQT
FK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaaattattcctgtcgctggcacttggcttgctggcatccgccagccatgca
gcaggcgatgtcgctgccggcaaacgcgtgtttgcgaaatgtgcgaattgccatcaggtc
gggccttctgcccgcggcaactttggaccacagctcaacggtatagtcggacgcacagcg
ggaacgacaaaggattacaagtattctgcggcgatgagttcttcccgcgtcgtgtggacc
gaggcgaacctacgcgccttcattcaatcgacgaatgatgtgataccgggtaacaagatg
cgcttctttggcatcagcgatgaaaagcagatcacggacttgctggcttatctgcaaacc
ttcaaataa

DBGET integrated database retrieval system