KEGG   Janthinobacterium sp. Marseille: mma_0882Help
Entry
mma_0882          CDS       T00561                                 

Gene name
acs
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mma_0882 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mma_0882 (acs)
   00620 Pyruvate metabolism
    mma_0882 (acs)
   00640 Propanoate metabolism
    mma_0882 (acs)
  Energy metabolism
   00680 Methane metabolism
    mma_0882 (acs)
Enzymes [BR:mms01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     mma_0882 (acs)
Lipid biosynthesis proteins [BR:mms01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   mma_0882 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001747..1003741
Genome map
AA seq 664 aa AA seqDB search
MEGTMSSIESFKQEERVFNPPVDFVNNAAISGMDAYNALCTEAAEDYEGFWARLAQQNVL
WSKPFTKRLDESNAPFYKWFEDGELNVSYNCLDRHLTNGNADKVALIFESDDGKVTRVTY
KELYERVCKFANGLKELGIQKGDRVIIYMPMSIEGVAAMQACARIGATHSVVFGGFSAKS
LQERIIDAGAVAVLTSDYQVRGGKNLPLKSIVDEALALGGCDTIRNVVVYKRTGGEMNFV
AGRDIWLHDLVDKQKAECEPVPVGAEHPLFILYTSGSTGKPKGVQHSSGGYLLWAMLTMK
WSFDIKPNDVYWCTADIGWITGHTYVTYGPLACGATQIVFEGVPMFPNAGRFWDMVQKHK
VTIFYTAPTAIRSLIKAADADPAVHPSKYDLSSLRLLGSVGEPINPEAWMWYYKNIGGER
CPIADTFWQTETGGHVISPMPGATPMVPGSCTLPLPGIAAAVVDEVGHDLANGKGGLLVI
KRPWPSMIRNIWNDPERFQKSYFPHELGGTIYLAGDGAIRNEETGYFTITGRIDDVLNIS
GHRMGTMEIESALVANPIVAEAAVVGKPDETTGESICAFVVLKRSRPTGDEAKQIAKELR
DWVAKEIGPIAKPKEIRFGDNLPKTRSGKIMRRLLRVLAKDEVITQDISTLENPAILEQL
KQAQ
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
ttggaggggacaatgtccagcatcgagagcttcaaacaagaggagcgggtattcaatccg
cctgtagatttcgtaaacaatgccgccatcagcggcatggatgcgtataacgctctatgt
actgaagccgcggaagactacgaaggattctgggcgcgcctggcgcaacagaatgtcttg
tggagcaaaccgttcaccaaacgactcgatgagtcgaatgcgcctttctataaatggttc
gaagacggtgagctcaacgtctcctataactgcctcgatcgccacctcaccaacggcaat
gccgacaaagtcgcgctgatttttgaatcagacgacggcaaggtgacacgtgtcacttat
aaggaactctacgaacgcgtctgcaaattcgccaacggcttgaaagagctgggcatccaa
aagggcgatcgcgtcattatctatatgccgatgtcgatcgaaggcgtagccgcaatgcaa
gcctgcgcccgtatcggtgctacgcattccgtcgtattcggtggtttctcggccaagtcg
ctgcaggaacgcatcatcgatgccggcgcggttgcggtactgacttcggattaccaggtg
cgcggcggtaaaaacctgccactgaaatccatcgtcgatgaagcgctggcgctgggcggt
tgcgacaccatccgcaatgtcgtggtctacaaacgcaccggtggtgagatgaatttcgtc
gccggccgcgacatctggctgcacgacctggtcgacaaacaaaaagccgaatgcgaaccg
gttcctgtcggtgccgagcatccattattcatcctctacacttccggttcgaccggcaag
ccaaaaggcgtccagcattcatccggcggctatctgctgtgggcgatgctgacgatgaag
tggagtttcgacatcaagccgaacgatgtttactggtgtaccgccgacattggctggatc
accggccacacctatgtgacctacggcccattggcttgcggcgcgacacaaatcgtattc
gaaggcgtaccgatgttcccgaacgccggtcgcttctgggacatggtgcaaaagcacaag
gtcaccatcttctacactgcaccgaccgcaatccgttcgctgatcaaggcggcggatgca
gatcctgcagtccacccaagtaaatacgatctgtccagcctgcgtttgctgggttcggta
ggcgagcctatcaatccggaagcatggatgtggtactacaaaaacattggcggcgaacgt
tgcccgatcgctgacaccttctggcagacagaaaccggcggtcacgtcatctcgccgatg
ccgggcgcaacgcctatggtgccgggttcctgtaccttgccattgcctggtattgctgcg
gcggtggtcgatgaagtcggtcacgacctggcaaacggcaaaggcggcctgctggtcatc
aagcgcccatggccatcgatgatccgcaacatctggaacgaccctgagcgcttccagaag
agctacttccctcatgaactgggcggcaccatctatctcgccggcgacggtgcgatccgc
aatgaagaaaccggttacttcaccattaccggtcgtatcgatgacgtgctgaacatttcc
ggtcaccgcatgggaacgatggaaatcgaatctgcattggtagccaatcctatcgtggcc
gaagctgcggtagtcggtaaaccggatgaaaccaccggcgaatcgatttgcgccttcgtg
gtcctcaagcgtagccgtccgaccggcgacgaagccaaacagatcgcgaaggaattgcgt
gactgggtcgcgaaagaaatcggtcctatcgccaagccgaaggaaatccgttttggcgac
aacctgccgaaaacccgttccggcaaaatcatgcggcgtctcttgcgtgtattggcgaaa
gacgaagtcatcacacaggatatttccactctggaaaatccggccatcctggaacagttg
aagcaggcgcaatag

DBGET integrated database retrieval system