KEGG   Janthinobacterium sp. Marseille: mma_0882Help
Entry
mma_0882          CDS       T00561                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00010  Glycolysis / Gluconeogenesis
mms00620  Pyruvate metabolism
mms00640  Propanoate metabolism
mms00680  Methane metabolism
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01120  Microbial metabolism in diverse environments
mms01130  Biosynthesis of antibiotics
mms01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mma_0882 (acs)
   00620 Pyruvate metabolism
    mma_0882 (acs)
   00640 Propanoate metabolism
    mma_0882 (acs)
  Energy metabolism
   00680 Methane metabolism
    mma_0882 (acs)
Enzymes [BR:mms01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     mma_0882 (acs)
Lipid biosynthesis proteins [BR:mms01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   mma_0882 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABR89208
UniProt: A6SWC5
Position
1001747..1003741
Genome map
AA seq 664 aa AA seqDB search
MEGTMSSIESFKQEERVFNPPVDFVNNAAISGMDAYNALCTEAAEDYEGFWARLAQQNVL
WSKPFTKRLDESNAPFYKWFEDGELNVSYNCLDRHLTNGNADKVALIFESDDGKVTRVTY
KELYERVCKFANGLKELGIQKGDRVIIYMPMSIEGVAAMQACARIGATHSVVFGGFSAKS
LQERIIDAGAVAVLTSDYQVRGGKNLPLKSIVDEALALGGCDTIRNVVVYKRTGGEMNFV
AGRDIWLHDLVDKQKAECEPVPVGAEHPLFILYTSGSTGKPKGVQHSSGGYLLWAMLTMK
WSFDIKPNDVYWCTADIGWITGHTYVTYGPLACGATQIVFEGVPMFPNAGRFWDMVQKHK
VTIFYTAPTAIRSLIKAADADPAVHPSKYDLSSLRLLGSVGEPINPEAWMWYYKNIGGER
CPIADTFWQTETGGHVISPMPGATPMVPGSCTLPLPGIAAAVVDEVGHDLANGKGGLLVI
KRPWPSMIRNIWNDPERFQKSYFPHELGGTIYLAGDGAIRNEETGYFTITGRIDDVLNIS
GHRMGTMEIESALVANPIVAEAAVVGKPDETTGESICAFVVLKRSRPTGDEAKQIAKELR
DWVAKEIGPIAKPKEIRFGDNLPKTRSGKIMRRLLRVLAKDEVITQDISTLENPAILEQL
KQAQ
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
ttggaggggacaatgtccagcatcgagagcttcaaacaagaggagcgggtattcaatccg
cctgtagatttcgtaaacaatgccgccatcagcggcatggatgcgtataacgctctatgt
actgaagccgcggaagactacgaaggattctgggcgcgcctggcgcaacagaatgtcttg
tggagcaaaccgttcaccaaacgactcgatgagtcgaatgcgcctttctataaatggttc
gaagacggtgagctcaacgtctcctataactgcctcgatcgccacctcaccaacggcaat
gccgacaaagtcgcgctgatttttgaatcagacgacggcaaggtgacacgtgtcacttat
aaggaactctacgaacgcgtctgcaaattcgccaacggcttgaaagagctgggcatccaa
aagggcgatcgcgtcattatctatatgccgatgtcgatcgaaggcgtagccgcaatgcaa
gcctgcgcccgtatcggtgctacgcattccgtcgtattcggtggtttctcggccaagtcg
ctgcaggaacgcatcatcgatgccggcgcggttgcggtactgacttcggattaccaggtg
cgcggcggtaaaaacctgccactgaaatccatcgtcgatgaagcgctggcgctgggcggt
tgcgacaccatccgcaatgtcgtggtctacaaacgcaccggtggtgagatgaatttcgtc
gccggccgcgacatctggctgcacgacctggtcgacaaacaaaaagccgaatgcgaaccg
gttcctgtcggtgccgagcatccattattcatcctctacacttccggttcgaccggcaag
ccaaaaggcgtccagcattcatccggcggctatctgctgtgggcgatgctgacgatgaag
tggagtttcgacatcaagccgaacgatgtttactggtgtaccgccgacattggctggatc
accggccacacctatgtgacctacggcccattggcttgcggcgcgacacaaatcgtattc
gaaggcgtaccgatgttcccgaacgccggtcgcttctgggacatggtgcaaaagcacaag
gtcaccatcttctacactgcaccgaccgcaatccgttcgctgatcaaggcggcggatgca
gatcctgcagtccacccaagtaaatacgatctgtccagcctgcgtttgctgggttcggta
ggcgagcctatcaatccggaagcatggatgtggtactacaaaaacattggcggcgaacgt
tgcccgatcgctgacaccttctggcagacagaaaccggcggtcacgtcatctcgccgatg
ccgggcgcaacgcctatggtgccgggttcctgtaccttgccattgcctggtattgctgcg
gcggtggtcgatgaagtcggtcacgacctggcaaacggcaaaggcggcctgctggtcatc
aagcgcccatggccatcgatgatccgcaacatctggaacgaccctgagcgcttccagaag
agctacttccctcatgaactgggcggcaccatctatctcgccggcgacggtgcgatccgc
aatgaagaaaccggttacttcaccattaccggtcgtatcgatgacgtgctgaacatttcc
ggtcaccgcatgggaacgatggaaatcgaatctgcattggtagccaatcctatcgtggcc
gaagctgcggtagtcggtaaaccggatgaaaccaccggcgaatcgatttgcgccttcgtg
gtcctcaagcgtagccgtccgaccggcgacgaagccaaacagatcgcgaaggaattgcgt
gactgggtcgcgaaagaaatcggtcctatcgccaagccgaaggaaatccgttttggcgac
aacctgccgaaaacccgttccggcaaaatcatgcggcgtctcttgcgtgtattggcgaaa
gacgaagtcatcacacaggatatttccactctggaaaatccggccatcctggaacagttg
aagcaggcgcaatag

DBGET integrated database retrieval system