KEGG   Janthinobacterium sp. Marseille: mma_1313Help
Entry
mma_1313          CDS       T00561                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mma_1313 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mma_1313 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    mma_1313 (thrC)
Enzymes [BR:mms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     mma_1313 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1483825..1485342
Genome map
AA seq 505 aa AA seqDB search
MPESSCFLSKPATNQIYYSMQYISTRGLAPALSFSEILLGGLAPDGGLYLPETYPQVSDA
ELDAWRTLSYADLAYEVLRKFATDIPDADLKALVHKTYTADVYRNVRHGEEAARITPLRT
VEEKNGSKLVLQALSNGPTLAFKDMAMQLLGNLFEYTLAKNHAELNIFGATSGDTGSAAE
YAMRGKKGIRVFMLSPHKKMSAFQTAQMFSLQDPNIFNIAVEGVFDDCQDMVKAVSNDHG
FKQQQKIGTVNSINWARVVAQVIYYFRGYLSATTSNEQKVSFTVPSGNFGNICAGHIARM
MGLPIDKLVAATNENDVLDEFFRTGVYRVRKSAETYHTTSPSMDISKASNFERFVYDLLG
RDGDRVRALFQKVETHGGFDLSGKPGSDGDEFKDIAKFGFASGKSTHSDRVATIRDLQNK
YELMIDTHTADGVKVAREHMTPGVTMIVLETALPAKFNETIREALGRDADRPAGFENIED
LPQRFEVMPADVEQMKTFIARHTGL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatcatcctgtttcctgagcaagccggccaccaaccaaatctattactctatg
caatacatttccactcgcggcctggcgccggcgctatcgttttctgaaattttgctgggc
ggtttggcgcctgatggtggcttgtatctgcctgagacttacccgcaggtcagtgacgcc
gaactcgatgcctggcgcaccttgtcctacgccgacctggcttacgaagtgctgcgcaag
ttcgcgaccgatattccggacgccgacctcaaggcgctggtacataaaacctatactgcg
gatgtctaccgcaatgtgcgccatggcgaagaagccgcgcgcatcacgcctttgcgtacg
gtagaagagaaaaacggcagcaagctggtcttgcaagccttgtcgaacggcccgacgctc
gccttcaaggatatggcgatgcaattgctcggcaatctgttcgaatacacattggccaag
aaccatgcggagttgaatattttcggcgctacttcgggcgataccggtagtgcggcggaa
tatgcgatgcgcggcaagaagggcatacgtgtcttcatgctgtcgccgcacaagaagatg
agcgccttccagactgcgcaaatgttcagcctgcaagacccgaatattttcaatattgcg
gtggaaggcgtattcgacgattgccaggacatggtcaaggcggtgtcgaatgatcacggc
ttcaagcaacagcaaaaaatcggtaccgtgaattcgatcaactgggcgcgtgtcgtggcg
caagtgatttactacttccgcggttacctgagcgcgaccaccagcaatgaacaaaaagta
tcgttcaccgtaccatcgggtaatttcggcaatatctgcgcaggccatatcgcacgcatg
atgggcttgcctatcgataagctggtcgcagcgaccaatgaaaacgatgtgctggatgag
ttcttccgcaccggcgtgtatcgcgtccgtaaatcggccgaaacttatcacaccaccagc
ccgagcatggatatcagcaaggcgtccaacttcgagcgcttcgtctatgatttgctgggc
cgcgatggcgaccgcgtgcgtgccttgttccagaaagtggaaacgcatggcggcttcgat
ctgtccggcaagccgggcagcgatggcgacgaattcaaggatattgcgaagtttggtttt
gcttccggcaaatcaacgcatagcgaccgcgttgccaccatccgtgacttgcaaaacaag
tacgaactgatgatagacacgcatacggccgatggcgtcaaggtcgcgcgcgaacacatg
acgcccggcgtcaccatgatcgtgctggaaaccgccttgccggccaaattcaatgaaacc
atacgggaagcactgggacgtgacgctgatcgtcctgccggttttgaaaatattgaagac
ttgccgcaacgttttgaagtgatgccggccgatgtcgaacagatgaaaacattcatcgcc
cgtcataccggcttgtaa

DBGET integrated database retrieval system