KEGG   Janthinobacterium sp. Marseille: mma_1328Help
Entry
mma_1328          CDS       T00561                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00230  Purine metabolism
mms01100  Metabolic pathways
Module
mms_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    mma_1328 (gmk)
Enzymes [BR:mms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     mma_1328 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 MMR_HSR1 RsgA_GTPase ABC_tran AAA_22 AAA_29 Dynamin_N AAA_23
Motif
Other DBs
NCBI-ProteinID: ABR88283
UniProt: A6SXM1
Position
complement(1506300..1506944)
Genome map
AA seq 214 aa AA seqDB search
MSEQAHSSGSLFLVVAPSGAGKSSLVNALLQQEPSIKLSISYTTRPPRPGEQHGREYFFT
SVDDFLARRQSNEFLESAEVFGNYYGTSRIQIADQMAAGTDVLLEIDWQGAQQVKKQFPH
AVGIFILPPSIAALEERLKKRGQDEDHVITRRILAAGGEIAHASEFEYVIINQEFTVALA
ELSAIVKATRCRFAQQSTRNASLFAQLGIHANLS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaagcccattcttccggcagcctgtttttagtcgtagcgccgtccggcgcc
ggcaaatccagcctggtcaacgccctgttgcaacaggaaccaagcatcaagttgtcgatt
tcctacaccacgcgcccaccgcgcccgggtgaacagcatggccgcgagtatttctttacc
tcggtagatgacttcctggcacgccgccaaagcaatgaattcctcgaatcggctgaggtt
tttggcaactattacggtacttccaggatacaaattgccgaccagatggcggccggtacc
gatgttttgctggaaattgactggcaaggcgcgcagcaggtgaaaaagcaattcccgcat
gctgtcggcattttcatcctgccaccgtcgattgcggcactggaagaacgcctgaaaaag
cgcggacaggacgaagatcacgtcattacccgcagaatcctggctgccggcggcgaaatc
gcccacgcttccgagttcgaatatgttattatcaatcaagagtttacagttgctttagct
gagttgagcgcgatcgtaaaagccacccgttgtcggtttgcacaacaatcaactcgcaac
gcatccctgttcgcccaattgggcattcatgccaatttaagctga

DBGET integrated database retrieval system