KEGG   Janthinobacterium sp. Marseille: mma_1375Help
Entry
mma_1375          CDS       T00561                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    mma_1375 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    mma_1375 (nagZ)
Enzymes [BR:mms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     mma_1375 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1553796..1554848
Genome map
AA seq 350 aa AA seqDB search
MNAVNPAGKFGPVMLDVVGTTLSADDIRRIQHPLTGGVILFARNYTDRAQLTALTAAIHA
ARPGIVIAVDHEGGRVQRFKTDGFTHLPAMRKLGALWDKDVLAATKAATDVGYVLAAELR
ACGVDLSFTPVLDLDYGESGVIGDRAFHRDARVVTMLAKSLNHGLMLAGMLNCGKHFPGH
GFVKADSHLEIPVDERELKQILAADAAPYDWLGLSLAGVMPAHVIYPKVDKHPAGFSRKW
LTMLRKDFGFDGLIFSDDLSMEGASVAGTVIDGAHAALQAGCDMVLICNSPDKADQLLAG
LQVRDNKATQESAVRIAALTPQSPALTWDALQQDARYIAAKKAAKALAAA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagtaaatccagcaggaaaattcggcccggtaatgctcgatgtggtgggtacc
accctgagcgcagatgatatccgccgtatccagcatccgctgaccggcggtgtgattttg
ttcgcgcgcaactataccgatcgcgcgcaattgacggctttgacggcagctatccatgca
gcgcgtccgggtatcgtgattgcggtcgaccatgaaggtggtcgcgtacaacgtttcaag
actgatggcttcacccatctgccggcaatgcgcaagctcggcgctttatgggacaaggat
gtattggccgcgaccaaggctgcgaccgatgttggctatgtattggcggcggaattgcgt
gcttgtggtgttgacctgtcgtttacacctgtactggatctggactacggcgaatcgggt
gtaatcggcgatcgcgcctttcatcgtgatgcacgggtagtgacgatgctggccaagagc
ctgaaccacggcctgatgctggccggcatgctcaattgcggcaaacattttcctggtcac
ggctttgtcaaagcggattcgcatctggaaatcccggtcgatgaacgtgaattgaagcaa
atcctggccgcagatgctgcaccatacgattggttgggcctgagcctggccggtgtgatg
ccggcgcatgtaatctatccgaaagtcgataaacatccggctggtttttcacgcaaatgg
ctgacgatgttgcgcaaggatttcggttttgacggtttgattttcagcgacgacctcagc
atggaaggtgcgagtgtcgcaggtactgtgattgatggtgcgcatgcagccttgcaggcc
ggctgcgacatggtgctgatctgcaattcaccggataaggcggatcagttgctggccggt
ttgcaggtcagggataacaaggcgacacaggaatccgcagtgcgcattgccgcattgacg
ccacagtcgccggcactcacatgggatgccttgcagcaggatgcgcgctatatcgctgcg
aagaaggcggcaaaagcgctcgctgcagcttaa

DBGET integrated database retrieval system