KEGG   Janthinobacterium sp. Marseille: mma_1507Help
Entry
mma_1507          CDS       T00561                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mma_1507 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    mma_1507 (sdhD)
   00650 Butanoate metabolism
    mma_1507 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    mma_1507 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697149..1697514
Genome map
AA seq 121 aa AA seqDB search
MPTDNIGRHRLVVGAHYGVRDWLAQRITAIVMVLYTLVLLIAFLTATDFSYEGWAGLFAQ
QWFKMFTFVTFLSLFYHAWVGMRNIWMDYIKPVSIRLALQVATILWLVACAGWTAQILWR
A
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgccaactgacaatatcggacgtcaccgcctggtggttggtgcgcactacggtgtaagg
gactggctggcccagcgtatcacggccatcgtgatggtgctgtacaccctggtactgctg
atcgcattcctgaccgccactgatttcagttatgaaggctgggcgggtctgttcgcgcag
caatggttcaagatgtttacgtttgttaccttcctgtccttgttttatcacgcctgggta
ggcatgcgtaacatctggatggattacatcaaaccggtttcaatacgcctcgcattgcag
gtcgccacgattttgtggctcgtcgcttgcgccggatggacggcgcaaattctctggaga
gcgtaa

DBGET integrated database retrieval system