KEGG   Minibacterium massiliensis: mma_1513Help
Entry
mma_1513          CDS       T00561                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mms  Minibacterium massiliensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:mms01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mms00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mms00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1704918..1706189
Genome map
AA seq 423 aa AA seqDB search
MAILEVKVPQLSESVAEATLLQWHKKVGETVARDENLIDIETDKVVLELPAPDAGVITQI
VRADNSTVVAGEVIALIDTDLSAVAIPAAVAPLAATTPASAPAPAASAPAAASNSASGIA
MPAAAKMLAENNLSTSDVAGSGKDGRVTKGDVINQLAKPAAAPAAAAPAAAAKPALQQVA
APAAPSAALANRPEERVPMSRLRARIAERLLQSQSSNAILTTFNEVNMQPVIDLRTKYKD
KFEKEHGVKLGFMSFFVKAAVAALKKYPIINASVDGNDIVYHGYFDIGIAVGSPRGLVVP
ILRDADQMSIAEIEKKIGEFGNKAKDGKLTLDDLTGGTFSISNGGIFGSMLSTPIINPPQ
SAILGIHATKERAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLL
LDL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcaattctagaggtaaaagttccgcaattgtcggaatcagttgcagaggcaacactg
ctgcaatggcataaaaaggtgggcgagactgtagcccgtgatgaaaacctgatcgatatc
gaaaccgataaagtcgtgctggaactgccggcacctgacgcgggcgtgatcacgcaaatc
gtgcgtgctgataacagtaccgtggtcgcgggtgaagtcatcgcgctgatcgatactgat
ttgtcagcggtggcaatccctgctgcagtcgcaccattggcggcgaccacgccagcgagt
gcgccggcaccggcggcgagcgcacccgccgcagcgtcgaacagcgccagcggtatcgcg
atgcctgccgccgccaaaatgctggcggaaaacaatctgtccaccagcgatgtcgcaggc
agcggcaaggatggtcgtgtcaccaaaggtgatgtgatcaaccagctcgccaagccagca
gctgctccggcagctgcagcgccagccgcagctgcgaaaccagcactgcaacaggtcgcg
gcaccggccgcaccatcggctgcactggcgaatcgtccggaagagcgcgttcctatgagc
cgcttgcgtgcacgtatcgctgagcgtctgctgcaatcgcaatcgagcaacgcgattctg
acgaccttcaacgaagtcaacatgcagccggtcatcgacttgcgtaccaagtacaaggac
aagttcgaaaaagaacatggcgtcaaactgggctttatgtccttctttgtcaaagctgca
gttgctgcgttgaaaaaatatccgatcatcaatgcatcggtcgatggcaatgacatcgtc
taccacggctacttcgatatcggtatcgcagtcggttcgccacgcggcctggtagtgcct
atcctgcgcgatgcggatcaaatgtcgattgctgaaatcgaaaagaaaatcggtgaattc
ggtaacaaggccaaggatggcaagttgacacttgacgacctgactggcggtacattctcg
atttcgaacggcggtatctttggctccatgctgtcgacacctatcatcaacccaccgcaa
tcggcgatcctgggcatccacgcaacgaaagaacgtgcagtggtggaaaacggccagatc
gtgattcgcccgatgaactatctggcgatgtcctacgaccatcgcatcatcgatggccgt
gaagcggtattgggcctggtagcgatgaaggaagcattggaagatcctgcgcgcctgctg
ctggacctctaa

DBGET integrated database retrieval system