KEGG   Janthinobacterium sp. Marseille: mma_1538Help
Entry
mma_1538          CDS       T00561                                 

Gene name
tesA2
Definition
acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    mma_1538 (tesA2)
Enzymes [BR:mms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     mma_1538 (tesA2)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     mma_1538 (tesA2)
Lipid biosynthesis proteins [BR:mms01004]
 Fatty acid synthase
  Component type
   mma_1538 (tesA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1731927..1732586)
Genome map
AA seq 219 aa AA seqDB search
MPINFKFSYQVEIAKRVLRTAALLMLTAFTMNAYSASKTIVVLGDSLSAEYGLARGEGWV
SLLQKKLEAEKISAPIVNASISGETTSGGAARLQALLDKHQPAVVVIELGANDALRGLSL
IATQQNLRTMVAASKKAKAKVLLVGMQIPPNYGTDYTRQFAELYPKIAKETKSALVPFML
KDVADKANLFQADRIHPSAEAHPVILNNIWPQLKPLLAK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaatttcaagttttcgtatcaggtggaaatagcaaagagagtactgaggaca
gcggcattgctcatgctcacggcgttcacaatgaacgcttattctgcatcaaaaaccata
gtcgtgctcggcgacagcctgtcagccgaatatggactggcgcgcggcgaaggttgggtc
agtcttttgcaaaagaaactggaagcggaaaaaatcagtgcgcccatcgtcaacgccagt
atcagcggtgaaacaaccagcggcggtgctgcccgcctgcaggcattattggacaaacac
cagccggcggtagtggtaattgaactcggtgccaacgacgccctgcgcggtttgtcgctg
atcgcgacccagcaaaacctgcggactatggtagcggcatcgaaaaaagcgaaagccaaa
gtcttattggtcggcatgcaaatcccacccaactacggtaccgattacacccgtcaattc
gccgagctgtatcccaaaatagcgaaagaaacaaaatccgcactggtgcccttcatgctg
aaggatgtcgccgacaaagccaatctgttccaggccgaccgcattcatccgtcggcagaa
gcgcatccggtcatactgaataatatctggccgcaactcaagccattgctggcaaagtaa

DBGET integrated database retrieval system