KEGG   Janthinobacterium sp. Marseille: mma_1859Help
Entry
mma_1859          CDS       T00561                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    mma_1859 (folE)
Enzymes [BR:mms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     mma_1859 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2090613..2091209
Genome map
AA seq 198 aa AA seqDB search
MKQPIHTDPAKPDDFSTEDWRRLLTHLGENADRQGLRETPQRVEKAWKHWTSGYDQDPAE
ILKVFEDGAEQYNELIVVRGIPVYSHCEHHLAPFFGTATIGYTPNGKIVGLSKLTRLVDC
FAKRLQVQERLTIQIADTLMEHVQPLSVGVVIRCRHMCMESRGIRTPGEETVTSALLGEM
RTNLGLRNEFLMLAREKD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagcctatacatactgatccggcaaaacccgacgacttctcaacggaagactgg
cgtcgtttattgacccatcttggcgaaaacgcagaccgccagggtttgcgcgaaacaccg
cagcgcgtggaaaaagcatggaagcactggacctcgggttacgaccaggatccggcggaa
atcctcaaggtctttgaagacggtgccgagcaatacaatgaattgatcgtggtgcgcggc
atcccggtctacagccattgcgaacatcatctggcacccttcttcggcaccgccaccata
ggctatacaccgaatggcaagatcgtcggcctgtccaagctgacacgcctggtggattgc
tttgccaagcgcctgcaagtgcaggaacgcctgacgatacagatcgccgacacgctgatg
gaacacgtacagcctttatcggtgggtgttgtgatccgctgccgtcatatgtgcatggaa
agccgcggcatccggacaccgggtgaagaaaccgtgacctcggcattgctcggtgaaatg
cgtaccaacctcggcctgcgcaatgaattcctgatgctggcacgcgagaaagactga

DBGET integrated database retrieval system