KEGG   Minibacterium massiliensis: mma_1910Help
Entry
mma_1910          CDS       T00561                                 

Definition
acetyltransferase
Organism
mms  Minibacterium massiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2140440..2141033)
Genome map
AA seq 197 aa AA seqDB search
MKQTLPQQPTLVGTTVELRPLQKEHAAQLVQAATDGELWNMKVTVIPGPDTVGQYIATAL
EGRANETVMPFVIVRRDTGQIVGSTRFWKIDLANRKMEIGHTWLGSSTQRSGINTEAKLL
LLSYAFETLQAIRVQFTTDELNEKSRAAILRIGAKQEGIVRNERIMPDGRKRNSVRFSII
DSEWDEVKAMLQQKMAR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaacactcccgcagcaaccgaccctggttggcacaaccgtagaactccgccct
ttgcaaaaagaacatgccgcgcaattggtacaagccgcgaccgatggtgagttgtggaat
atgaaggtcaccgtgatcccggggccggatacggtggggcaatacattgcgacggcgctg
gaaggacgtgcaaacgaaacggtcatgcctttcgtcatcgtgcggcgcgataccggccag
atcgtgggcagtacccgtttctggaagatagacctggcgaaccgaaaaatggaaatcggc
catacctggctcggcagttcgacccagcgttccggcatcaatacggaagcgaagctcttg
ttgctgagctatgcctttgaaacgctgcaggccatacgcgtgcaattcacgaccgatgaa
ttgaatgaaaaatcgcgtgcggcgattttgcgcataggcgccaaacaggaaggcatcgtc
aggaacgaacgcatcatgccggatggtcgcaagcgcaactcggtgcgcttcagcatcatc
gattccgagtgggatgaggtgaaggccatgctgcagcaaaagatggcgcgctaa

DBGET integrated database retrieval system