KEGG   Janthinobacterium sp. Marseille: mma_1942Help
Entry
mma_1942          CDS       T00561                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00620  Pyruvate metabolism
mms00630  Glyoxylate and dicarboxylate metabolism
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01120  Microbial metabolism in diverse environments
mms01200  Carbon metabolism
Module
mms_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    mma_1942 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    mma_1942 (aceB)
Enzymes [BR:mms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     mma_1942 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABR89161
UniProt: A6SZD5
Position
complement(2186057..2187655)
Genome map
AA seq 532 aa AA seqDB search
MTESTIDIPAGIEIEGEFKADYEQVLTPDALALVVKLSRSFEARRQELLAIRVQRAKRID
AGERPDFLPETAAIRAADWRIAPIPEALACRRVEITGPVDRKMVINAFNSGADVYMADFE
DANTPNWENQIEGQLNLIDAVRGSITTERNGKQYKLNARIATLMVRPRGWHLDEKHVLVD
GKRVSGGIFDFALFMFHNAHELHKRGEGPFFYLPKLESHLEARLWNDIFVMTQRELGLPQ
GTIKATVLIETILAAFEMDEILYELKDHSAGLNAGRWDYIFSCIKKFRLDKDFCLADRAK
VTMTVPFMRSYALLLLKTCHRRGAHAMGGMAALIPIKNDPVKNELAMNAVRIDKERDAID
GYDGGWVAHPGLVELAMTEFKKVLGDKPNQIGKLRDDVHATADDLLDFQPETPITEAGLR
YNINVGIHYLGSWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSNKGVLDDGRKITAEM
VRPMIQEELLKVKQDAPNGSSPSYVRAAQIFEEMSTSTSFAEFLTLPLYEEI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactgagagcacgatagacatcccggcaggaatagaaattgaaggcgaattcaaagca
gactacgaacaggtgttgacgcctgatgcgctggcgctggtcgtcaaactgagccgcagc
tttgaagcacgccgtcaggaattgctggcgattcgagtccaacgtgccaaacgtatcgat
gccggcgagcgtcctgatttcctgccggagacagcagccatccgcgccgccgactggcgg
attgcgccgatcccggaagcgctggcttgccgccgcgtggaaatcaccggcccggtcgat
cgcaagatggtgatcaatgccttcaactcgggtgccgatgtgtatatggccgattttgaa
gatgcgaatacgccgaattgggaaaaccagatcgagggccagctcaatctgatcgacgcc
gtgcgcggtagtatcaccactgagcgcaatggcaagcaatacaagctcaatgccaggatc
gcgaccctgatggtgcgcccgcgcggctggcatctggatgaaaagcatgtactggtggat
ggcaagcgggtctcgggtggcatcttcgattttgcactgttcatgttccacaacgcacat
gaattacataagcgcggtgaagggccattcttctatttgccgaaactggagtcacacctg
gaagcgcgcctgtggaatgacatcttcgtcatgacgcaacgcgaactgggcctgccgcaa
ggcacgatcaaggcaaccgtcctgatcgaaaccatcctcgccgcattcgagatggatgaa
atcctgtatgagctgaaagaccatagcgccggtttgaatgccggacgctgggattacatc
ttttcgtgcatcaagaaattcaggctggacaaagacttttgcctggcggatcgcgccaag
gtcacgatgaccgtgcctttcatgcgttcctacgccttgctcttgctgaagacctgccat
cgtcgcggcgcacatgcaatgggcggcatggctgcactgatcccgatcaagaacgatccg
gtcaagaatgagctggcgatgaatgcggtgcgcattgataaggaacgcgatgcgatagac
ggctacgacggcggctgggtggcacacccgggcctggtcgagctggcaatgacggagttc
aagaaagtcctgggcgataaaccgaaccagatcggcaagttgcgcgacgacgtgcatgcg
acggcggatgacttattggacttccagccggaaacaccaatcaccgaagccggcttgcgt
tacaacatcaacgtcggtatccattacctcggcagctggctggacggcaatggctgcgtg
cctatccataacctgatggaagatgcggcgactgccgagatcagccgttcgcaagtctgg
caatggatacgttcaaacaagggtgtgctggatgacggtcgcaagatcaccgccgaaatg
gtgcgtccgatgatccaggaagaattgctgaaggtgaagcaggacgcgccgaatggcagc
agcccaagctatgtccgtgctgcgcaaattttcgaagaaatgtcgacctcgacttcgttt
gcagaattcctcactctgcctttgtacgaagaaatttga

DBGET integrated database retrieval system