KEGG   Janthinobacterium sp. Marseille: mma_2064Help
Entry
mma_2064          CDS       T00561                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    mma_2064 (galU)
   00052 Galactose metabolism
    mma_2064 (galU)
   00500 Starch and sucrose metabolism
    mma_2064 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    mma_2064 (galU)
Enzymes [BR:mms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     mma_2064 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2329535..2330410)
Genome map
AA seq 291 aa AA seqDB search
MSKIRKAVFPVAGLGSRFLPATKAQPKEMLPVVDKPLIQYAVEEAVAAGITDMVFITGRN
KRAIEDHFDTAYELEAELEAANKNALLELVRNVIPKNINCIYIRQSAPLGLGHAVLCARP
VIGNDPFAVLLADDFMDTDEGVKPVLAQMTDVFQREGHSILAVQDVPRAETKQYGIVSAT
AYQPQLELVNAIVEKPQPDVAPSTLAVVGRYVLSNKIFDYLETIGKGAGGEIQLTDGIAA
LMQAEKVLAYRYNGQRYDCGSKLGYLKAMVAMGLKHPETGAGFTEYLKTLK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattagaaaagccgttttccccgtcgcaggcctcggcagccgtttcctgcca
gctaccaaggcgcaaccaaaagaaatgctgccagtcgttgacaagcctttgattcagtat
gcggtggaagaagcggtggcggccgggattacggatatggtcttcattaccggccgtaac
aagcgcgcgattgaagatcatttcgataccgcttatgaactggaagccgagctggaagcc
gccaacaagaatgccttgctggagctggtgcgtaacgtcattcccaagaatatcaattgc
atctatatacgccagtcggcgccactgggtctcggtcatgccgtcctgtgcgcacgtccg
gtgatcggtaacgatccgtttgccgtgttgctggcggatgacttcatggataccgatgaa
ggcgtcaaaccggtgctggcgcagatgacggatgtgttccagcgcgaaggccacagcata
ctcgcggtacaggatgtgccgcgcgccgaaacgaagcaatacggcatcgtcagtgcgact
gcataccagccgcaactggagctggtgaatgcgattgtggaaaaaccgcagccagatgtc
gcaccatcgacgctggccgtggttgggcgctatgtgctgagcaacaagattttcgattat
ctggaaacgatcggcaaaggtgccggcggtgaaatacaattaacggacggcatagctgcg
ttgatgcaggccgagaaggtgctggcttatcgttacaacggccagcgttatgactgcggt
tccaagctgggctacctgaaggcaatggtggcgatgggtcttaagcatcctgaaaccggt
gcaggtttcactgaatatctgaagacattgaaatga

DBGET integrated database retrieval system