KEGG   Janthinobacterium sp. Marseille: mma_2072Help
Entry
mma_2072          CDS       T00561                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mma_2072 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    mma_2072 (dapE)
Enzymes [BR:mms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     mma_2072 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2341342..2342469
Genome map
AA seq 375 aa AA seqDB search
MSKTLALTEELIALSSVTPEDKGCQSRLIELLEPLGFVCETIESDGVTNLWARKGTTQPL
LVFAGHTDVVPTGPLEQWTSPPFVPTQREGKLYGRGAADMKTSIAAMVVAAEEFVQAHPA
HKGSIGFLITSDEEGPATDGTVIVCNALKARGEQLDYCVVGEPTSSDVLGDTIKNGRRGS
MSGKLTVKGIQGHIAYPQLARNPIHQCAPALAELVAEKWDDGNEYYLPTSWQVSNIHGGA
GASNVIPGNVVIDFNFRFCTASTVDGLQKRVHAILDKHGLEYDLKWSISGHPFLTPKGTL
SDAMSDAIKSETGVTTELSTTGGTSDGRFIAQICPQVVEFGPPNGSIHKIDEHIEVRFID
PLKNIYRRTMENLLL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacgctcgcactgaccgaagaactgatcgcactttcctccgttacaccggaa
gacaaaggctgccaatcgcgcctgatcgaattgctggaaccgctgggcttcgtttgcgaa
accatagagtcggatggcgtgaccaatctgtgggcacgcaagggtacaacgcagccactg
ctggtatttgccggtcataccgacgtcgtgcctaccggcccgctggaacaatggacctcg
ccgcctttcgtcccgacgcaacgcgaaggcaagctgtacggccgtggcgcagcggatatg
aaaacctcgatcgccgcgatggtcgtcgccgccgaagaattcgtacaggcacaccctgcg
cataaaggctcgatcggcttcctcatcaccagcgatgaagaaggccctgcgaccgatggc
accgtgatcgtctgtaatgccttgaaggcacgcggcgagcaactcgactactgcgtggtg
ggtgaaccgacttcatccgatgtattgggcgataccatcaagaatggtcgccgcggcagc
atgtccggcaagctcaccgtcaagggtatacaaggccatatcgcttacccgcaattggcg
cgcaatcctatccaccaatgcgcacctgcattggcggaactggtcgccgaaaagtgggat
gacggcaatgaatactatctgccgacttcatggcaggtttcaaacatccacggtggtgcc
ggtgcatcgaatgttatcccgggcaatgtcgtcatcgatttcaacttccgcttctgcacc
gccagcacggtagacggcttgcaaaaacgcgtgcatgcgatcctcgacaaacatggcctc
gaatatgatttgaaatggtctatcagcggccatcccttcctcacgccgaaaggtacactg
agcgatgcgatgagcgatgcgatcaaatccgaaaccggcgtgacgacagaattgtcgacc
accggcggcacctcggatggtcgcttcattgcgcagatctgcccgcaagtcgtcgaattc
gggccaccgaatggcagcatccacaaaatcgatgagcacatcgaagtccgcttcatcgat
ccgctgaaaaacatctatcgccgcacaatggaaaacctgttgctctaa

DBGET integrated database retrieval system