KEGG   Janthinobacterium sp. Marseille: mma_2136Help
Entry
mma_2136          CDS       T00561                                 

Gene name
pcm1
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mms  Janthinobacterium sp. Marseille
Brite
Enzymes [BR:mms01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     mma_2136 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2406897..2407775)
Genome map
AA seq 292 aa AA seqDB search
MTEKKRFPLSLSSIAEKAPRSGARTEVNRSSTSGKVATPQTATQNASQHGKRTITPARPA
EVPRKAAAAPSSNERATPLVSEAVRKAMTARVAKQGVKDSKVLAAMDAVPRHLFMEPALA
SQAYIDASLPIGYHQTISQPYIVARMIEVMRNNQQGGVLNRVLEIGTGCGYQAAVLSLVA
KEVYSIERIKGLHELAKANLRPMRVANIRLHYGDGMLGLPQAAPFDGIILAAAGLEVPQA
LLEQMTIGGRLVAPVGERHQVLQLIERVSKFEWKSSTLEDCHFVPLRPGTVT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaaaaagcgtttcccgctctcgctgtcatcgattgcagagaaagccccgcgc
agtggtgcccggaccgaagtaaaccgcagtagcacttccggcaaagtggcaaccccacaa
acagccacccagaatgcttcgcaacacggcaaacgcacgattacgccggcgcgtccggca
gaagtgccgcgcaaggcagccgccgcgccgtcttccaacgagcgcgccacgcctttggta
tccgaggcggtgcgcaaggcaatgaccgcccgggtcgcaaaacaaggggtaaaagacagc
aaggtattggcggcgatggatgccgtgccacgtcatttattcatggagccggcactggcg
agccaggcttatatcgatgcttcgttgccaattggttatcatcaaaccatctcgcagcca
tacatcgttgccagaatgattgaagtcatgcggaacaatcagcagggtggcgtactcaat
cgggtgctggaaatcggaaccggctgcggttatcaggctgcagtcttgtcgctggtggcc
aaggaagtctattccatcgaacggatcaagggcttgcatgaattggcaaaagccaatttg
cggccgatgcgggttgcaaatatccgcttgcattacggagatggtatgcttggcttaccc
caggcagcaccgttcgacggcatcattttggctgccgccggactggaagtgccgcaggct
ctgctggaacaaatgacaataggtgggcgcctggtcgccccggttggcgaacgtcatcag
gtattgcaactgatagaacgcgtcagcaaatttgaatggaaaagttcgacgctggaggat
tgccattttgtgccactccgtccaggtaccgtgacttag

DBGET integrated database retrieval system