KEGG   Janthinobacterium sp. Marseille: mma_2163Help
Entry
mma_2163          CDS       T00561                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mma_2163 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mma_2163 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mma_2163 (trpA)
Enzymes [BR:mms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mma_2163 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2437001..2437798)
Genome map
AA seq 265 aa AA seqDB search
MSRIQSTLAALAAKNKKGLIPFITAGDPAPELTVPLMHALVAGGADILELGVPFSDPMAE
GPVIQRACERALASGVSMHDVLGFVSEFRKTNNSTPVVLMGYANPIERMGQTKFILAAKA
AGVDGTIVVDYPPEECEEFAATLKENDMDPIFLLSPTSTEERIQQVAKFGSGFSYYVSLK
GVTGAANIDTKEVAERIAAIRKYVKLPIGVGFGIRDAATAKAVAQVSDAVVIGSRIIQEL
ENSPREQAVERVQTFIAGIRKALDE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaattcagtccaccctggccgcattggcggccaagaataaaaaaggcctcatt
cctttcatcactgccggtgatccagcgcctgagctgaccgtgccgctgatgcatgcactg
gttgccggcggtgccgatatcctcgagctgggcgtgcctttttccgacccgatggcggaa
ggcccggtcatccagcgcgcctgcgaacgtgcattggcatccggcgtgagcatgcatgat
gtcctcggcttcgtcagcgaattccgcaagaccaataacagtaccccggtagtcctgatg
ggttatgccaatccgatcgaacgcatgggacaaaccaaattcatcctggccgccaaggcg
gccggcgtggacggcaccatcgtcgtggattacccgccggaagagtgcgaagagtttgcc
gccacgctgaaggaaaacgatatggatcctatcttcctgttgtcgccgacctcgaccgag
gaacgcatccagcaggtcgccaaattcggcagcggtttcagctactatgtctcgctcaag
ggtgtgactggtgcggccaatattgatacgaaggaagtggcggaacgtatcgcggctatc
cgtaaatatgtgaagctgcctattggtgtcggtttcggtatccgcgatgcggcgacggcc
aaggcggtagcgcaggtttccgatgcagtggtgatcggcagccggatcatccaggaactg
gaaaacagcccgcgcgagcaagctgttgaaagagtgcaaacgtttattgccggcatccgc
aaggctttggacgaataa

DBGET integrated database retrieval system