KEGG   Janthinobacterium sp. Marseille: mma_2164Help
Entry
mma_2164          CDS       T00561                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mma_2164 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mma_2164 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mma_2164 (trpB)
Enzymes [BR:mms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mma_2164 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2437896..2439167)
Genome map
AA seq 423 aa AA seqDB search
MKELDALGSFAERQAIAESALHQTAPYNLPDARGHFGPYGGSFVAETLSHALAELKEAYA
HYSKDPSFLAEFHYDLKHFVGRPSPIYHAKRWSEKMGGAQIYFKREDLNHTGAHKINNVI
GQALLAKRMGKPRIIAETGAGQHGVATATICARFGLECVVYMGSEDVKRQAQNVYRMKLL
GATVVPVESGSKTLKDALNEAMRDWVTNIENTFYIIGTVAGPHPYPMMVRDFQSVIGNEC
IEQMPEMTSRQPDYVVACIGGGSNAMGIFYPYIEHKNVQLVGVEAAGEGLESGKHSASLT
AGSPGVLHGNRTYLLQDENGQIIETHSVSAGLDYPGVGPEHSWLKDSGRAQYVSITDEEA
LQAFHDCCHIEGIIPALESSHALSYAAKLAATLPKDKVVLANLSGRGDKDMHTVAQRMGL
QFD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagacgcgctgggcagttttgccgagcgacaagcaattgcagaaagcgcc
ttgcaccagactgcaccatacaacctgccggatgcacgcggccacttcggtccttacggc
ggcagcttcgtggcggaaaccctgagccacgccctggccgagctgaaggaagcgtatgca
cactacagcaaggatccgtctttcctcgccgaattccattacgacctgaagcatttcgtc
ggtcgtccgagcccgatttaccacgccaaacgctggtctgaaaaaatgggcggcgcgcag
atttacttcaagcgtgaagacctgaatcacaccggcgcacacaaaatcaataacgtgatt
ggccaggccttgctcgccaagcgcatgggcaagccgcgcatcattgcggaaaccggtgcc
ggccagcatggcgtggcaaccgcgacgatttgcgcacgctttggcctggagtgcgtggtc
tatatgggcagtgaagacgtcaagcgccaggcgcaaaacgtctaccgcatgaagttgctt
ggtgcgaccgtggtgccggtcgaatccggttccaagacactcaaggatgcgctgaatgaa
gcgatgcgcgactgggtcacgaatattgaaaataccttctacatcatcggcacggtagcc
ggtccgcatccatacccgatgatggtgcgcgacttccagtcggtgattggtaatgagtgc
atagaacaaatgccggaaatgaccagccgccagcctgactacgtggtggcttgtatcggc
ggtggctcgaatgcgatgggtattttctatccgtatatcgaacacaaaaatgtacaactg
gtcggcgtcgaagcagcgggtgaggggctggaaagcggcaagcattcagcttcattgacg
gccggttcgcctggcgtcctgcatggcaatcgtacttatttgctgcaggatgaaaacggc
cagatcatagaaacgcattctgtttccgccggcctcgattatccgggcgtgggccctgag
cattcatggctgaaagactcgggtcgcgcgcaatatgtgtcgattaccgatgaagaagcc
ttgcaggctttccacgactgctgccatatcgaaggcatcatcccggcactggaatccagc
catgcactgagttatgcagccaagctggcagccaccttgccgaaagataaagtggtattg
gccaacctttccggtcgtggcgacaaggatatgcatacggtagcgcaacgcatgggtttg
caattcgattaa

DBGET integrated database retrieval system