KEGG   Janthinobacterium sp. Marseille: mma_2164Help
Entry
mma_2164          CDS       T00561                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00260  Glycine, serine and threonine metabolism
mms00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01130  Biosynthesis of antibiotics
mms01230  Biosynthesis of amino acids
Module
mms_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mma_2164 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mma_2164 (trpB)
Enzymes [BR:mms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mma_2164 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABR88359
UniProt: A6T007
Position
complement(2437896..2439167)
Genome map
AA seq 423 aa AA seqDB search
MKELDALGSFAERQAIAESALHQTAPYNLPDARGHFGPYGGSFVAETLSHALAELKEAYA
HYSKDPSFLAEFHYDLKHFVGRPSPIYHAKRWSEKMGGAQIYFKREDLNHTGAHKINNVI
GQALLAKRMGKPRIIAETGAGQHGVATATICARFGLECVVYMGSEDVKRQAQNVYRMKLL
GATVVPVESGSKTLKDALNEAMRDWVTNIENTFYIIGTVAGPHPYPMMVRDFQSVIGNEC
IEQMPEMTSRQPDYVVACIGGGSNAMGIFYPYIEHKNVQLVGVEAAGEGLESGKHSASLT
AGSPGVLHGNRTYLLQDENGQIIETHSVSAGLDYPGVGPEHSWLKDSGRAQYVSITDEEA
LQAFHDCCHIEGIIPALESSHALSYAAKLAATLPKDKVVLANLSGRGDKDMHTVAQRMGL
QFD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattagacgcgctgggcagttttgccgagcgacaagcaattgcagaaagcgcc
ttgcaccagactgcaccatacaacctgccggatgcacgcggccacttcggtccttacggc
ggcagcttcgtggcggaaaccctgagccacgccctggccgagctgaaggaagcgtatgca
cactacagcaaggatccgtctttcctcgccgaattccattacgacctgaagcatttcgtc
ggtcgtccgagcccgatttaccacgccaaacgctggtctgaaaaaatgggcggcgcgcag
atttacttcaagcgtgaagacctgaatcacaccggcgcacacaaaatcaataacgtgatt
ggccaggccttgctcgccaagcgcatgggcaagccgcgcatcattgcggaaaccggtgcc
ggccagcatggcgtggcaaccgcgacgatttgcgcacgctttggcctggagtgcgtggtc
tatatgggcagtgaagacgtcaagcgccaggcgcaaaacgtctaccgcatgaagttgctt
ggtgcgaccgtggtgccggtcgaatccggttccaagacactcaaggatgcgctgaatgaa
gcgatgcgcgactgggtcacgaatattgaaaataccttctacatcatcggcacggtagcc
ggtccgcatccatacccgatgatggtgcgcgacttccagtcggtgattggtaatgagtgc
atagaacaaatgccggaaatgaccagccgccagcctgactacgtggtggcttgtatcggc
ggtggctcgaatgcgatgggtattttctatccgtatatcgaacacaaaaatgtacaactg
gtcggcgtcgaagcagcgggtgaggggctggaaagcggcaagcattcagcttcattgacg
gccggttcgcctggcgtcctgcatggcaatcgtacttatttgctgcaggatgaaaacggc
cagatcatagaaacgcattctgtttccgccggcctcgattatccgggcgtgggccctgag
cattcatggctgaaagactcgggtcgcgcgcaatatgtgtcgattaccgatgaagaagcc
ttgcaggctttccacgactgctgccatatcgaaggcatcatcccggcactggaatccagc
catgcactgagttatgcagccaagctggcagccaccttgccgaaagataaagtggtattg
gccaacctttccggtcgtggcgacaaggatatgcatacggtagcgcaacgcatgggtttg
caattcgattaa

DBGET integrated database retrieval system