KEGG   Janthinobacterium sp. Marseille: mma_2328Help
Entry
mma_2328          CDS       T00561                                 

Gene name
recR
Definition
(GenBank) Recombinational DNA repair protein (RecF pathway)
  KO
K06187  recombination protein RecR
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mms00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    mma_2328 (recR)
DNA repair and recombination proteins [BR:mms03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     mma_2328 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      mma_2328 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH
Motif
Other DBs
NCBI-ProteinID: ABR89322
UniProt: A6T0H1
Position
complement(2605035..2605631)
Genome map
AA seq 198 aa AA seqDB search
MKTPSSLDFLTEALRRLPGVGPKSAQRMAYHLMQHDRDGAAMLGRALSQAVEKVQHCAMC
NTFTEHEVCETCLDAERNPALLCVVETPGDQLMIEQTLTFKGLYFVLMGRLSPLDGIGPK
DIHLEKLISRATDGIVQEVVLATNFTNEGEATAHYISETLKARGLKVSRLARGVPVGGEL
EYVDAGTIARAMLDRRTT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaccgtcaagcctagatttcctgactgaagccctgcgtcgcctgccgggcgtc
ggcccgaaatcggcgcaacgcatggcttaccacctgatgcagcacgatcgtgatggtgcc
gccatgctgggacgtgccttgtcgcaggcggtggaaaaggtgcagcactgtgcgatgtgc
aataccttcaccgagcatgaggtatgcgaaacctgcctcgatgccgagcgtaacccggcc
ttgctgtgcgtggtcgaaacgccgggtgatcagttgatgatagagcagacgctgactttc
aagggtttgtactttgtgttgatggggcgcctgtcgccgctggatggcataggccccaag
gatatccatctcgaaaaattgatcagccgtgctaccgacggcatcgtgcaggaagtagtg
ctggcgacgaattttacgaatgaaggcgaggcaactgcgcactacatcagcgaaacgctg
aaagcgcgcggcctcaaagtcagccgcctggcgcgtggtgtgccggttggtggcgaactg
gaatatgtagacgccggtacgatagcgcgtgcgatgctggatagacgcacgacgtaa

DBGET integrated database retrieval system