KEGG   Janthinobacterium sp. Marseille: mma_2572Help
Entry
mma_2572          CDS       T00561                                 

Definition
Guanyl-specific ribonuclease Sa (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
mms  Janthinobacterium sp. Marseille
Brite
Enzymes [BR:mms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     mma_2572
Transfer RNA biogenesis [BR:mms03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    mma_2572
 Prokaryotic Type
    mma_2572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2900155..2900529)
Genome map
AA seq 124 aa AA seqDB search
MKVKFITRFFLFFATFLLSYNAFAFDSGALGVVSVNDLPREAQQTIAMIRQGGPFPYDKD
GSVFGNYEKVLPQQKRGYYREYTVKTPRARNRGARRIITGGEKSKPREYYYTADHYRSFK
RVME
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttaaattcatcacacgttttttcctgtttttcgctacattcttactttcttac
aacgcttttgctttcgattccggcgcgctgggcgttgtttcagttaatgatttgccgcgt
gaagcgcagcagaccatcgccatgattcgccagggcggacctttcccttacgacaaggat
ggttcggtatttggcaattatgaaaaggttttgccgcagcaaaagcgcgggtattaccgt
gaatacacagtaaaaacgccgcgcgcccgcaatcgcggtgcgagacgcatcattaccggg
ggcgagaagagcaagccgcgcgaatattattacaccgccgatcactatagaagcttcaaa
agagtcatggagtga

DBGET integrated database retrieval system