KEGG   Minibacterium massiliensis: mma_2788Help
Entry
mma_2788          CDS       T00561                                 

Definition
phage-related lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mms  Minibacterium massiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3128440..3128964
Genome map
AA seq 174 aa AA seqDB search
MGRGAELLVPRARVRPGAAVIEVPKAAIELAKRFEGFERRVKRGVEITAIPYICPAGFWT
IGYGHLCDPKHPPITEAEAEVYLVRDLQTALAATLRFCPVLATEPEGRLAAVVDFTFNLG
VGRLQTSTLRRRVNQRDWPTAASELRRWVYGGGKVLPGLVTRREAEAAWLLRNA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgggccggggtgctgaacttctggttcctcgggcgcgtgttcgaccgggtgcggccgtg
attgaggtaccaaaagcggccattgaactggcaaagcgcttcgagggattcgagcgcagg
gtgaagcgcggagtcgagatcactgccattccctacatctgccccgcaggcttctggacg
attggctatggccatctctgcgatcccaagcatccgccgatcacggaggcagaagccgag
gtctatctggtgcgcgatctgcagactgcactggcggcgacgctgcgcttctgcccagtg
ctggccactgagccggaggggcggctcgcggccgttgtggacttcacgttcaacctcggc
gtggggcggctgcagacatcaacgctgcgacggcgggtcaatcagcgggactggcctacc
gcagcgagtgaactgcgccgatgggtctatggcggcgggaaagtgctgccaggactcgtc
actcggcgcgaggctgaggcagcttggctgcttcgcaacgcctga

DBGET integrated database retrieval system