KEGG   Janthinobacterium sp. Marseille: mma_2791Help
Entry
mma_2791          CDS       T00561                                 

Definition
(GenBank) C-term domain of type III restriction enzyme
  KO
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mms  Janthinobacterium sp. Marseille
Brite
Enzymes [BR:mms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     mma_2791
Prokaryotic defense system [BR:mms02048]
 Restriction and modification system (R-M system)
  Type III R-M system
   mma_2791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3131172..3131864)
Genome map
AA seq 230 aa AA seqDB search
MLKATETDKNVHSIHSVVKYDLIGKIAEGTQLTRRTTADILKEINVAVFAQFRTNPESFI
AEAVRLINEQKATMIIEHLAYDPVEDKFDIDIFTAGQTKQDFSKAGDKLKRHIYDYVITD
SGIERKFVETLDTCTEVVVYAKLPRGFLIPTPVGDYNPDWAISFKEGAVKHVYFVAETKG
SMSTMQLTKIEETKIECARKFFDEINRKYAPENVKYDVVKSFDKLMDLVK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaaggccactgaaaccgataagaacgtgcattcgattcactcggtagtgaagtac
gacctcatcggcaagatcgctgaaggcacgcaactgacgcgccgcacgacggcggacatc
ctgaaggaaatcaacgtcgcagtgtttgcacagttccgcaccaatcccgagagcttcatc
gccgaagccgtgcgactgatcaacgagcagaaggcaacgatgatcatcgaacacttggcc
tacgaccctgtcgaggacaagttcgatatcgacatcttcaccgcaggtcagaccaagcag
gacttcagcaaggccggtgacaagctcaagcggcacatctacgactacgtgatcacggat
tccggcatcgagcgtaaattcgtcgagacgctcgacacctgcaccgaagtggtcgtgtac
gccaaattaccccgaggcttcctgatcccgacgccagtgggtgactacaaccctgactgg
gcaatttcgttcaaagagggtgccgtcaagcacgtctacttcgtggcggagaccaagggg
tccatgtcaacgatgcaattgacgaagatcgaggaaaccaagatcgaatgcgcgcgcaag
ttcttcgacgaaatcaaccggaaatatgcccctgaaaacgtcaagtacgacgtggtgaaa
agcttcgataagttgatggatttggtgaagtga

DBGET integrated database retrieval system