KEGG   Janthinobacterium sp. Marseille: mma_2875Help
Entry
mma_2875          CDS       T00561                                 

Gene name
folK
Definition
(RefSeq) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
  KO
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    mma_2875 (folK)
Enzymes [BR:mms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     mma_2875 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3226765..3227247
Genome map
AA seq 160 aa AA seqDB search
MTAVTAYIAIGSNLGDARDHVLYALRQLDQLASTRLLAQSSLFRTAPIDSSGDDYINAVA
SVSTSLSAEELLRALLALEQTRGRERPYFNAPRTLDLDLLLYGDAVINTDTLTVPHPRMT
SRAFVLIPLLQIDPFVQIPGLGAAHQFAPAVADQAISKLA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtcacagcctacatagccataggctcgaatctcggcgatgcccgggatcat
gtcttgtacgccttgcgtcagctggatcagctcgcgtccactcgcctgctcgcgcagtcc
tcgctgtttcgtaccgcaccgatagattccagcggcgacgattacatcaatgcggttgca
tctgtcagcaccagcctgtcagccgaagaattgctgcgggctttgctggcgctggaacag
acacgcggccgtgaacgcccttacttcaacgcaccgcgcacgctggatcttgacctgctg
ctgtatggtgacgcggtaatcaacaccgacacactgaccgtgccgcatccacgcatgacc
agccgcgccttcgtattaattccattgctgcaaatcgatcccttcgtgcagatcccggga
ctgggggcagcacatcaatttgcaccggcggtagcggatcaggccattagcaagctggcc
tga

DBGET integrated database retrieval system