KEGG   Janthinobacterium sp. Marseille: mma_3127Help
Entry
mma_3127          CDS       T00561                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00900  Terpenoid backbone biosynthesis
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    mma_3127 (ispE)
Enzymes [BR:mms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     mma_3127 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ABR88561
UniProt: A6T2S0
Position
3499254..3500123
Genome map
AA seq 289 aa AA seqDB search
MTLTLNHCPAPAKLNLFLHVTGRRADGYHLLQSVFQLIDRGDVLHFATRDDNLIQRTTDL
PGVPAESDLVVRAAKLLQTVATEKNPAKNFGADIAVEKKLPMGGGLGGGSSDAATTLLAL
NHLWQTGLSRAELMALGLQLGADVPFFIFGQNAFAEGIGEALVEVETPDRWFVVIEPGVS
VPTPQIFSSTELTRDTKPVKISDFSGAQESFGKNDLQVVAEKLFPPIAEAIQWLGQYGDA
RMTGSGACVFCPFEQEQQADAVLTTVPPHWKAWKAKAIKHHPLAYLQQS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacacttacccttaatcactgcccggcaccggccaagctgaacctcttcctgcatgtc
accggacgacgtgcggacggctaccatttgctgcaaagcgtattccagctgatagatcgc
ggcgacgtgctgcactttgctacacgcgacgataatttgatacagcgcacgacagatttg
cccggcgtaccggctgaaagtgatctggtagtacgcgcagccaaattattacaaacagtg
gcaacagaaaaaaatccggcaaaaaatttcggtgccgatatcgccgtggaaaaaaagctg
ccgatgggtggcggacttggcggcggctcatccgatgccgccacgaccctgctggccctg
aatcatttatggcaaaccggcctgagccgtgcggaattgatggcgctgggcctgcaattg
ggagccgacgtaccgttttttatctttggtcaaaatgcctttgccgagggtataggcgag
gctttggtagaggtagaaacgccggatcgctggtttgttgtaatcgaacccggggtttca
gtgccaaccccgcagatattttcatcaactgaattgacaagggatacgaaacccgtcaaa
atatcggacttttccggagctcaagaaagcttcggcaaaaacgacctgcaagtcgtggct
gaaaagttgtttccaccgattgccgaagccatccaatggctgggacaatacggagatgca
agaatgacaggatccggcgcttgtgtgttttgcccgtttgagcaagaacagcaagccgat
gcagtactgacaacagtaccgccgcactggaaagcctggaaagccaaagcgatcaagcat
catccgctcgcttatttgcagcagtcgtga

DBGET integrated database retrieval system