KEGG   Minibacterium massiliensis: mma_3174Help
Entry
mma_3174          CDS       T00561                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mms  Minibacterium massiliensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mms00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mms00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3547841..3548605
Genome map
AA seq 254 aa AA seqDB search
MGCKKTSLAAKNLNHSALNSIVFYVSDSLKDYFFRTMTNRRSWCNMRHAYPPYYPLIMTK
QFIRLFLHAALVSTLGLGTQAFAQTGNAAASPAACPATLNYTLARLQDETPQNLCQYAGK
VILAVNTASYCGFTVQYEGLEQLYAKYKDRGLVILGFASNDFGQQEPGANKEIAEFCHNT
YGVKFPMFAKSSVIGPNINPFYKSLMANGAQTPKWNFHKILLDRSGKVVESYPSKVTPDN
KKLVADIEKALAQK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgggatgcaaaaaaacctcattagctgctaaaaatttaaaccattcagcgctgaattca
atcgttttttatgtttctgacagcctaaaagattattttttccgcaccatgacaaaccgc
cgctcttggtgcaatatgagacacgcttatccgccctactacccccttatcatgacaaaa
caattcatccgcctgttcttgcacgccgccctggtaagcacccttggcctgggcacacag
gctttcgcccaaaccggcaatgccgcagccagcccggctgcctgtccggccacactgaat
tacacgcttgcccgtttgcaagacgaaaccccgcaaaacctttgccaatatgcagggaaa
gtaattcttgcagtcaacaccgccagttattgcggctttaccgtgcagtacgaagggctg
gagcagctctatgcgaaatacaaggatcgcggcctggtcatactgggcttcgcctccaat
gacttcggccagcaggaaccgggcgccaacaaggaaatcgccgagttttgccacaatacc
tatggcgtgaaattcccgatgttcgccaaaagctcggtaatcgggcccaacatcaaccct
ttttataagtcgctgatggcgaatggcgcgcaaacaccgaaatggaatttccataaaatc
ctgctggaccgcagcggcaaggtcgtcgaaagctatccgtccaaagtgacacctgacaac
aagaaactggtggctgacatagaaaaggcattggcgcagaaatag

DBGET integrated database retrieval system