KEGG   Janthinobacterium sp. Marseille: mma_3222Help
Entry
mma_3222          CDS       T00561                                 

Gene name
gpm2
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mma_3222 (gpm2)
   01230 Biosynthesis of amino acids
    mma_3222 (gpm2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mma_3222 (gpm2)
  Energy metabolism
   00680 Methane metabolism
    mma_3222 (gpm2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mma_3222 (gpm2)
Enzymes [BR:mms01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     mma_3222 (gpm2)
Exosome [BR:mms04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   mma_3222 (gpm2)
  Exosomal proteins of melanoma cells
   mma_3222 (gpm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3593874..3594620
Genome map
AA seq 248 aa AA seqDB search
MYKIVLMRHGESTWNLDNRFTGWADVDLTEKGRNEAKHAGELLREAGFTFDLAYSSVLKR
AIRTLWIALDEMDLMWIPVVCDWHLNERHYGALQGMNKAETAEKYGADQVLQWRRSYDIP
PKHLAEDDPRTMFDDPRYAHLQRAEIPLGECLKDTLLRVEPYWNDTIVPSIRAGKQIIIS
AHGNSLRALIKILDDISDQDIVSLSIPNGRPIVYELDENLKPIRHYYLGDQESLQAAVQA
AASHGQSK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaatcgtattgatgcgccacggcgagtccacatggaacctcgataaccgcttc
accggctgggccgatgtcgacttgacggaaaaaggtcgcaacgaagccaaacatgccggc
gaattgctgcgtgaagcaggctttacgtttgatctggcctattcctccgtgctcaagcgc
gccatccgcaccctctggattgcgctcgacgagatggatttgatgtggataccggtcgtt
tgcgactggcatctgaacgaacgtcattacggtgcgctgcaaggcatgaacaaggccgaa
acagctgaaaagtacggtgcagatcaggttttgcaatggcgccgcagctacgacattccg
ccaaaacacctggcagaagatgatccgcgtaccatgtttgacgatccccgctacgcccac
ctgcagcgcgcggaaatcccactgggcgaatgcctgaaagacaccttgctgcgcgtagaa
ccgtactggaacgataccatcgtgccatcgatacgcgccggcaaacaaatcatcatttca
gcccacggcaacagcctgcgtgcgctgatcaagattttggacgatatcagcgatcaggac
attgtctcgctcagcatcccaaatggtcgtcctatcgtctacgaactggatgaaaacctg
aaacccatacggcattactacctcggcgaccaggaatccctgcaagctgcagtacaggca
gccgccagccacggtcaaagcaagtaa

DBGET integrated database retrieval system