KEGG   Methylomonas methanica: Metme_0117Help
Entry
Metme_0117        CDS       T01511                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmt  Methylomonas methanica
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metme_0117
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Metme_0117
Enzymes [BR:mmt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Metme_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(122989..123954)
Genome map
AA seq 321 aa AA seqDB search
MHRHLQLTEQGKLKHFLSIEGLDKGLLTEILDTAESFAGISEHQVKKVPLLRGKTIVNLF
FENSTRTRTTFELAATRLSADVLNINIATSATSKGESLLDTIRNLEAMHVDMFVVRHALS
GAAHFIAQHTAPHISVINAGDGQHAHPTQAMLDMFTIRQHKKQFEGLKVAIVGDILHSRV
ARSQILALNTLGVAEVRVIAPKTLLPAHVRSMGVIPLHDMDEGLSDVDVIIMLRLQKERM
NSAFLPSESEFFKCYGLTEAKLLRAKPNAIVMHPGPINRGVEIASSVADGPQSVILEQVS
NGIAVRMAVMTMTLGHHGGAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtcatctgcaactcacagaacaaggcaaactcaagcattttctcagcatagaa
ggcctggacaaaggtttgctgacggagattctggataccgccgaatcctttgccggcatt
tccgaacatcaggtgaaaaaagtaccgctattgcgcggtaaaaccatcgtcaacctgttt
ttcgaaaacagcacccgcactcgtaccacgttcgaactggcggcaacccggctttccgcc
gacgtactgaacatcaacattgccacgtccgccacctccaagggcgaaagcctgttggat
accatccgcaatttggaagccatgcacgtcgacatgtttgtagtgcggcatgccttgagc
ggcgcggctcattttattgcgcaacataccgccccgcacatcagcgttatcaatgccggc
gacggccagcatgcccacccgactcaggccatgctggacatgttcactatacgccagcat
aaaaaacagttcgaaggcctgaaggtggccatcgtcggcgatattctgcactcgcgagtg
gcccgctcgcagattctggccctcaacaccttgggtgtcgccgaagtgcgggttatcgcc
cccaaaaccctgttaccggcccatgtccgcagcatgggcgtaattccgctgcatgacatg
gacgaaggtttgagcgatgtcgacgtgatcattatgttgcgcttgcaaaaggaacgcatg
aattcggcctttctacccagcgagagcgagttttttaaatgctacggtttaaccgaagca
aaactactgcgcgccaaacccaatgccattgtcatgcatccgggcccgattaaccgcggc
gtggaaatcgcttccagcgtggccgacggtccgcagtctgtgatactggaacaagtcagc
aacggtattgccgtacgcatggccgtcatgaccatgacgctgggccatcatggaggtgcg
gcatga

DBGET integrated database retrieval system