KEGG   Methylomonas methanica: Metme_0605Help
Entry
Metme_0605        CDS       T01511                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmt  Methylomonas methanica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metme_0605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metme_0605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metme_0605
Enzymes [BR:mmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metme_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
654339..655541
Genome map
AA seq 400 aa AA seqDB search
MTDKYDMPDARGHFGPYGGIFVAETLMPAITELNEAYQRYLVDPEFIAELDADLRDYVGR
PSPLYHAQRWSEHLGGAQIYLKREDLNHTGAHKVNNTVGQALLAKRMGKTRIIAETGAGQ
HGVATATVAARLGLECVVYMGAVDVARQALNVYRMKLLGATVVAVESGSKTLKDALNEAL
RDWVTNIDNTFYIIGTVAGPHPYPAMVRDFQAVIGREAKQQCIDQAGRLPDALVACVGGG
SNAIGLFYPFIDDKSVKMYGVEAAGDGIDTGRHSAPLCAGRPGVLHGNRTYLMADDDGEI
IETHSISAGLDYPGVGPEHSWLKDTGRANYVNITDDEALAGFHALTRMEGIIPALESSHA
LAYTMKLAPTMRKDQIIIVNLSGRGDKDMHTIMQREGISL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaatacgatatgccggatgctcggggccacttcgggccttatgggggtatc
tttgtagcggaaacgctgatgccggctataaccgaactgaatgaagcgtaccaacgctat
ttggtcgatccggaatttatcgccgaactcgatgccgacttaagagattacgtcggccgg
ccgtcgccgctatatcatgcccaacgctggagcgaacatttgggcggcgcgcaaatttat
ctgaagcgggaagacctgaatcataccggcgcgcacaaggtgaataacaccgtcggtcag
gctttgctggccaagcgtatgggtaaaacccgcatcatcgccgaaaccggcgccggccag
cacggcgttgccacggcaaccgtggccgcgcgtctgggtttggaatgcgtggtttacatg
ggcgcggttgacgtggcccgtcaggcgctgaacgtttatcgcatgaaattgttgggcgcc
accgtggtggcggtcgaatccggttccaaaaccctgaaggacgccctgaatgaagccttg
cgcgactgggtgaccaatatcgacaatactttttatattatcggtacggtggcggggccg
catccttatccggccatggtgcgggattttcaggcggttatcggccgcgaagccaaacag
cagtgcatcgatcaagccggccgtttgccggatgccttggtggcatgcgtcggcggcggt
tccaatgccatcggtttgttttatccgtttatcgacgacaaatccgtgaaaatgtacggc
gtcgaagcggcgggcgacggtatcgacaccggtcgccattccgcgccgttatgcgccggc
cgtccgggcgtattgcacggcaatcgtacctatttgatggccgacgacgatggcgaaatc
atcgaaacccattccatctccgccggattggattatcccggcgtcggtcccgagcactct
tggttgaaagataccggccgcgccaattacgttaatatcaccgatgacgaagccttggcg
ggttttcatgcgctgacgcggatggaaggcatcattccggccttggagtccagccatgcc
ttggcgtacaccatgaaactggcgcccaccatgcgcaaggatcaaatcattatcgttaat
ttgtccggacgcggtgacaaagacatgcacaccattatgcaacgcgaggggatcagttta
tga

DBGET integrated database retrieval system