KEGG   Methylomonas methanica: Metme_0606Help
Entry
Metme_0606        CDS       T01511                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmt  Methylomonas methanica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metme_0606
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metme_0606
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metme_0606
Enzymes [BR:mmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metme_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
655538..656341
Genome map
AA seq 267 aa AA seqDB search
MSRLANKFAELKTSGRKALIPFITAGDPYPEFTVPMLHEMVAAGADVIELGVPFSDPMAD
GPVIQRASERALAHKVGLRKVLSMAMEFRKTDQTTPLVLMGYLNPIEMMGYEDFANAAQR
ADVDGVLTVDLPPEEAVDCVALLRERGIDQIFLLAPNSDAERIAKMDAVGSGYLYYVSLK
GVTGAGHLNTEDVKEKLALIRANTGLPVGVGFGVKDADTAKIVANLADGVVVGSALISKI
EASLDDPGQARNEIIALLKSMRAAMDS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccttgccaataaatttgccgaacttaaaacctcgggccgcaaggcgctaatt
ccatttattactgccggcgacccgtatcccgagtttaccgtgccgatgctgcacgagatg
gtggcggccggggccgacgtgatcgaattgggcgtgccgttttccgatccgatggccgac
ggccctgtgatccagcgcgccagcgaacgcgccttggcgcataaggtgggcttgcgcaag
gttttgagtatggccatggaatttcgcaaaaccgatcaaaccacgccgttggtattgatg
ggttatctgaatcccatcgaaatgatgggctatgaagattttgccaatgccgcgcaacgc
gcggatgtcgatggcgtgttgacggtggatttgccgcccgaagaagccgtggattgcgtg
gctttgctgcgcgagcgcggcatcgatcagatttttctgctggcgcccaatagcgacgcc
gaacgtatcgccaaaatggatgcggtgggcagcggctatttgtattatgtgtctttgaag
ggcgtaaccggggccggtcatttgaataccgaggacgtcaaggaaaaactggcattaatc
cgggccaataccggcttgccggtaggggtcggttttggcgtgaaagatgccgataccgcc
aaaatcgtcgccaatttggccgatggcgtcgtggtggggagtgcgttgatcagcaaaatc
gaagccagtctggatgatcccgggcaggcgagaaacgagattattgccttgttgaaatcc
atgcgcgcggcgatggatagttaa

DBGET integrated database retrieval system