KEGG   Methylomonas methanica: Metme_0633Help
Entry
Metme_0633        CDS       T01511                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmt  Methylomonas methanica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Metme_0633
   00052 Galactose metabolism
    Metme_0633
   00500 Starch and sucrose metabolism
    Metme_0633
   00520 Amino sugar and nucleotide sugar metabolism
    Metme_0633
Enzymes [BR:mmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Metme_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
681231..682112
Genome map
AA seq 293 aa AA seqDB search
MTKKVTKAVFPVAGLGTRSLPATKAVAKEMLPVVDKPLIQYAVEEAIAAGIDTMIFVTGR
NKDSIPNHFDKSYELEKELEKSGKTELLKMLRELLPPHVSCVFVRQAEALGLGHAVHCAK
PIVGNEPFAVILPDDLIEDGTRGCMKQMVELFEKEQSSILGVERVDPKETHKYGIVEHNE
TAPGVGQLKSIVEKPKPEVAPSNIAVVGRYVLTPAIFEKIETTGRGAGGEIQLTDAIAAL
MQDEQVLSYEFKGNRYDCGSKFGFLLANVEYGLLHPEIKAEFADYLKQRVAKI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaagttaccaaagctgtttttcccgttgccggtcttggcacccgttcgttg
cccgcgactaaagccgtggccaaggaaatgctgccggttgttgataagcccctgattcaa
tatgcagttgaagaggccatagccgcgggtatcgacaccatgatattcgtgaccggtcgt
aacaaggattctatcccgaatcatttcgataaatcctacgaactggaaaaagagctggaa
aaaagcggtaaaaccgaattgttgaaaatgctgcgcgaattgttgccgccgcatgtgtct
tgcgtatttgtgcgtcaagcggaagcgttgggcttgggacatgcggtgcattgcgccaaa
cccatcgtcggaaacgagccgtttgcggtgattttaccggatgatctgattgaagacggt
acccgtggttgtatgaagcaaatggtggaattgttcgagaaagaacagagcagcatcctg
ggggttgaacgcgtcgatcccaaggaaacccataaatacggtatcgtcgaacataacgaa
accgcacctggcgtcggccaactgaagtcgatcgtcgaaaaacccaaacccgaagtggcg
ccgtccaatatcgccgtggtcggccgttacgtcttaacgccggctattttcgagaaaatc
gaaaccaccgggcgcggcgcgggcggtgaaatccaattgaccgatgccattgcggcgttg
atgcaagacgaacaggtcttgtcgtacgaatttaaaggcaatcgctacgattgcggctca
aaattcggtttcttgttggccaatgttgaatacggattgttacatccggaaatcaaagcg
gaattcgccgattatctgaaacaacgggttgcaaaaatctga

DBGET integrated database retrieval system