KEGG   Methylomonas methanica: Metme_0968Help
Entry
Metme_0968        CDS       T01511                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mmt  Methylomonas methanica
Brite
Enzymes [BR:mmt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Metme_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1046020..1047192
Genome map
AA seq 390 aa AA seqDB search
MRHFLLLILSAARYADVAQAADTPQPAAASVPAANPLLGLPPVPVPADNPQSPAKIALGD
KLFHDKRFSIDGTISCASCHDGSKAFTDNLPVSVGHHGLTGTRNAPTVINAAFYKFQFWD
GREQDLEGQAKGPFINPVEAGLPSHQPILDIVRSDPDYKAAFKEVFNVADAKLTMEHVVK
AIASFERSIVAGDSAFDRFYFQGDQSALNEQQKRGFQLFLGQGRCVSCHVIEQDQALFTD
NRFHNIGIGINAVQDDVPRLAQAFLEAKNKGGDVDQMVLTDKKSSELGRFAVTDGISEIG
AFKTPTLRNIALTAPYMHDGSLKTLKEVVIHYNNGGVTPASAPVNPYLSGGIRPLNLLDS
QIDDLAAFLDSLTSQQYLKSVVARPGENYE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgccactttctgttactgatcctgagtgctgcccgttacgccgatgtcgctcaggct
gccgatacgccccagccagccgccgcatcggtaccggccgccaacccgttgttgggcctg
ccgccggtgccggtacctgccgacaatccgcaatcgccggcgaaaatcgccttgggcgac
aaactgtttcacgataaacgcttttccatagacggcacgatcagctgtgcgtcgtgccat
gacggcagcaaagcctttaccgacaatctgccggtttcggtcggtcaccacggtttgacc
ggcacccgcaacgcgccgacggtaatcaacgcggcattttataaatttcaattttgggac
ggccgcgagcaggacttggaaggccaggccaaggggccgtttatcaatccggtggaagcg
ggtttgcccagccaccaacccattttggatatcgtgcgcagcgacccggactataaggcg
gcgttcaaggaggtattcaatgtcgccgatgccaagctgaccatggagcatgtggtcaaa
gccatcgccagcttcgaacgcagtatcgtggccggcgactcggccttcgaccgtttttat
ttccagggcgatcaaagtgcgttaaacgagcagcaaaagcgcggttttcaattgtttttg
gggcagggccgctgcgtgtcctgtcatgtgatcgaacaagaccaagccttgtttaccgat
aaccgctttcataatatcggcatcggcatcaatgccgtgcaggacgatgtgccccgtttg
gcgcaggcgtttttggaggctaaaaacaagggcggcgatgtcgatcaaatggtgctgacc
gacaagaaatcctccgaactgggccgctttgcggttaccgacggtatcagcgaaatcggc
gcttttaaaacgccgaccctgcgcaacattgctttgaccgcgccgtacatgcacgacggc
agcctgaaaaccttgaaagaggtggtcatccattacaacaacggtggggtaacgccggca
agcgcgccggtcaatccctatcttagcggcggtattcgacccttgaacctgctggacagc
cagatcgacgatctggcggcttttttggacagcctgaccagccagcaataccttaaatcc
gttgttgccagaccgggagaaaactatgaatga

DBGET integrated database retrieval system