KEGG   Methylomonas methanica: Metme_1077Help
Entry
Metme_1077        CDS       T01511                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mmt  Methylomonas methanica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metme_1077
Enzymes [BR:mmt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Metme_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1155297..1155842
Genome map
AA seq 181 aa AA seqDB search
MEEYFSKIIQAIGEDVNREGLRDTPKRAAKAFRFLNNGYEKSLDEVLNGAIFQADTEDMV
IVKDIELYSLCEHHLLPFIGKCHIGYLPQGKVLGLSKLARIVDMYGRRLQIQEQLTRQIA
TAVQTAINARGVAVVIEAKHLCMMMRGVEKQNSVMTTSVMTGIFREEISTRSEFLNLINR
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatatttctccaaaatcattcaagcaataggtgaagacgtcaatcgtgagggg
ttgcgcgatacgcccaagcgggcggccaaagcctttagatttttaaataacggttatgaa
aaaagcctggatgaagtgctgaatggggcgatttttcaagccgacaccgaggatatggtg
atcgtcaaggatatcgaattgtattcactgtgcgagcatcacttgttaccgtttatcgga
aaatgccatatcggttatttgccgcaaggcaaggtgttggggctatcgaaattggcgcgg
attgtggatatgtacggcaggcgtttgcagattcaggagcaactgacccgccaaattgcc
actgcagtgcaaactgccatcaatgcgcgaggggtggcggtggtgatcgaagccaagcac
ttatgcatgatgatgcgcggcgtggaaaaacaaaactcggtgatgacgacctcggtaatg
accgggattttccgcgaagaaatcagtacccgctccgaatttttgaatctgatcaatcga
aaataa

DBGET integrated database retrieval system