KEGG   Methylomonas methanica: Metme_1488Help
Entry
Metme_1488        CDS       T01511                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmt  Methylomonas methanica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Metme_1488
Enzymes [BR:mmt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Metme_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1630267..1630869
Genome map
AA seq 200 aa AA seqDB search
MIGFLRGKLIQKTPPQLVLDVQGVGYEVEAPMTTFYDLPALGQEVKLHTHLVVREDAHIL
FGFASETERMLFRTLIKVNGVGPKLALTILSGQSVAEFYRCVDDNDVKALVRLPGVGQKT
AERLIIEMRGRLPALSDSALEAGHNQTPATLGNSPKLEAITALCALGYKPPDAARMVQAI
AVEDKSCEDIIRLALRGTIK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggttttttacgcggtaaattgatccagaaaaccccgccgcagctggtgctggac
gtgcaaggcgtcggctacgaggtcgaagcgccgatgaccaccttctacgatttgccggca
ttgggccaggaagtcaagctgcatacccacttggtggtgcgggaagatgcgcatatcctg
ttcggctttgccagcgaaaccgagcgcatgctgtttagaaccttgatcaaagtcaacggc
gtcggtcccaagctggcgctaaccattttatccggacagagcgtagcggaattctaccgc
tgtgtcgacgataacgatgtcaaagccctggtgagattgccgggtgtcggccaaaaaacc
gccgaacgcctgattatcgaaatgcgcggccgtttgcctgccttgagcgattcggctttg
gaggcggggcataatcagacgcccgcgaccttgggtaacagccccaaactggaagctatt
accgctctgtgcgcattgggttataagccgccggatgcggccagaatggtgcaggctatc
gccgtggaggataaaagctgcgaggatattatccggttggcgctacggggcaccattaaa
tga

DBGET integrated database retrieval system