KEGG   Methylomonas methanica: Metme_1516Help
Entry
Metme_1516        CDS       T01511                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mmt  Methylomonas methanica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Metme_1516
Enzymes [BR:mmt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Metme_1516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1661935..1663413
Genome map
AA seq 492 aa AA seqDB search
MSALLNKRRAGVLLHISSLPGKGECGDMGQEAFNFINFLHDVGATVWQTLPLGMPHGDGS
PYQCLSAHAGNPAFISIEWLDEQGWLPTEENCSECHGGHAFWKSCLVGKAFYGFQSSAAK
VDLQDFKRFCKEKADWLDDFALFIALRNVFGHKCWNQWPEALKERRPQALKESTELLKSV
IEGIKFEQYVFFRQWHELKAYAREKDVLLFGDIPIFVSYDSADVWANRAVFKLNKAGDMD
VVAGVPPDYFSEFGQRWGNPHYDWEYLSKTDFQWWVDRIKSQNEMFDILRIDHFRGLEAA
WEIPANEDTAINGQWVKAPGHELLKAIENKFPNLALIAEDLGIITDEVEALRDDFDLPGM
KILQFAFDGHPDNPYLPMNFGHNAVAYTGTHDNDTTLGWFESLNDDEKQRVYDYLGWSTL
PMPDALVHAALGSAANLTVIPMQDILRLGSADRMNTPGTIEGNWHWRFNWSQLTEENAGR
FAHFIGMFGRHL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctctcttaaataaacgccgtgccggggtattgctacacattagctccttaccc
gggaaaggtgagtgtggtgacatggggcaagaggcattcaactttatcaattttctgcac
gatgtgggcgcaaccgtttggcagactttgcccttaggtatgccgcacggtgacggttcc
ccttaccaatgtctttccgcgcatgccggtaaccctgccttcattagtatcgaatggttg
gatgagcagggctggttgcccactgaagaaaactgttcggaatgtcatggcggccacgcg
ttttggaagagctgtttagtaggtaaagctttctacggcttccaatcgtcggctgcaaaa
gtggacctacaggattttaagcggttttgtaaggaaaaagccgattggctggatgacttt
gccttgttcattgccttgcggaatgtgtttgggcataaatgctggaaccaatggccggaa
gccttgaaggaaaggcgcccgcaggcgttaaaggagtcgacagagctgttgaagtcggtg
atagagggtatcaagttcgagcagtatgttttcttcaggcaatggcatgaattaaaagcg
tacgcgcgggaaaaggatgttttattgtttggcgatattccgatttttgtctcttacgat
agtgcggatgtctgggctaaccgggcggtgttcaagctgaataaagccggagatatggat
gtggtggctggcgtgccaccggactatttctccgaattcggacaacgttggggtaatccg
cattacgattgggaatatttaagcaagacggactttcaatggtgggtggaccgcatcaaa
agtcagaatgagatgttcgatattctgaggattgatcatttccgcggcttggaagcggct
tgggaaattccggccaacgaagataccgcgatcaacggacaatgggttaaggcgcctggt
cacgaactgctaaaagccatcgagaataaatttcccaatctggcattaattgcggaggat
ttggggattattactgacgaggtcgaggcgctaagggacgattttgatttgcccggtatg
aaaatcctgcaatttgcattcgacggtcatccggataatccctatttacctatgaatttc
ggacataacgcagtggcttacacaggtacccatgataacgataccaccttgggctggttc
gaaagcttaaatgacgacgaaaaacagcgggtgtacgattacttgggttggtccactctg
cccatgccggatgcgttggtgcatgccgcgctcggttcggccgctaatctgaccgtgata
ccgatgcaggatattttgcggttaggttcggcggatagaatgaatacgccaggcacaatt
gaaggcaattggcactggcgttttaattggtcgcaattgactgaagaaaatgccggacga
tttgcgcattttatcggtatgttcggcagacacctctaa

DBGET integrated database retrieval system