KEGG   Methylomonas methanica: Metme_1642Help
Entry
Metme_1642        CDS       T01511                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mmt  Methylomonas methanica
Brite
Enzymes [BR:mmt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Metme_1642
Secretion system [BR:mmt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Metme_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1803535..1804245
Genome map
AA seq 236 aa AA seqDB search
MKKISGILLFAAAMLTVNNVSADEAAIKKALGEFIPGAQVDSVKPSEVKGLFEVIAGGNI
FYASEDGRYLLQGQLFDAVEKKNITESKLANVRKAALDNVGEKNMIIFKPAASKHVVSVF
TDIDCGYCRKLHSEIDQYLAKGITVRYLFFPRAGKGSESYSKAVSVWCAADRQKALTDAK
KGDTLESKTCDNPVDQHMALGEAFGMSGTPMIVTEKGNILPGYVPAVQLAKILSNE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatctctggaattttattgtttgcggccgccatgctgacggtcaataacgtt
tccgcggacgaagcggcaattaaaaaagccttaggcgaattcattccgggcgcgcaagtc
gactccgttaaacccagtgaagtgaagggcttgttcgaggtgatcgccggcggcaacatt
ttctatgcttcggaagatggtcgctatttgttgcaaggccagttgttcgatgccgtcgaa
aagaaaaacatcaccgagagcaagctggcgaacgtacgcaaagcagccttggataatgtc
ggcgagaaaaacatgattatcttcaagccggcggccagcaaacatgtggtttccgtgttt
accgacatcgattgcggttattgccgcaaattgcattctgaaattgatcaatatctggcg
aaggggattaccgtgcgttatctgttcttcccacgggccggcaagggttccgagtcttac
tccaaagccgtatcggtctggtgcgctgccgataggcaaaaggccttaactgacgccaaa
aaaggcgataccttggaatccaaaacctgcgacaacccggtcgatcaacatatggccttg
ggcgaggcgttcggcatgagcggtacgccgatgatcgtcaccgagaaaggtaatattctg
ccgggttatgtgcctgcggtgcagttggcaaaaattttgagcaacgaataa

DBGET integrated database retrieval system