KEGG   Methylomonas methanica: Metme_1899Help
Entry
Metme_1899        CDS       T01511                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmt  Methylomonas methanica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metme_1899
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metme_1899
  Amino acid metabolism
   00310 Lysine degradation
    Metme_1899
Enzymes [BR:mmt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Metme_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2079965..2081173)
Genome map
AA seq 402 aa AA seqDB search
MSFDILVPSLPESVSDATLVAWHKQPGDWVEAGDNLADLETDKVILEVPAPSSGVVTEII
RPAGETVVGGELLARLDLQKQNPASATTEPAEKSSTTTHTEEPPLSPSVRKLVAENEIDP
SGISGSGKHGRILKTDVLDYLNEQQAAQEDPAATSEASHNPLSATAVASLRPEQRVPMTR
MRAKIAERLLQAQQNAAMLTTFNEVDLSAVIELRNQYKERFENKHNVKLGFMSFFVKASI
EALKRFPAINASIDGNDIIYHGYYDIGIAVTTPRGLIVPILRDADQLDFAGIEKGIHDFG
SKARNGSISVEDLSGGTFTITNGGIFGSMLSTPILNPPQCAILGMHAIKDRPVVEDGQIV
IRPIMYLALSYDHRLVDGKEAVQFLGIVKECLESPAHLLLNI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgacattctggttcccagtctccccgaatccgtgtccgacgccactttggtg
gcttggcacaaacaacccggcgactgggtggaggcaggcgacaatctggctgaccttgaa
accgacaaggtgattttggaagttcccgcgccgtccagcggcgtggtcactgaaattatc
cgccctgcgggcgaaaccgtggtgggcggcgaattactggccagactggacctacagaag
caaaaccccgcgtccgcaaccactgaaccagccgaaaagtcctccactaccactcacacc
gaagagccgcctttaagcccgtcggtgcgcaaactggtagcggaaaacgaaatcgaccca
tccggcattagcggttccggcaaacacggacggattttaaaaaccgacgtattggattat
ttaaacgagcaacaagccgcgcaggaagatccggccgcgacatccgaagccagccacaac
ccgctatccgctaccgccgtcgccagtttgcggcctgaacaacgcgtaccgatgacccgc
atgcgggccaaaattgccgagcgtttgctgcaggcgcaacaaaatgcggccatgctgacc
acattcaacgaagtcgacctgtcggccgtgattgaattacgcaatcaatataaggagcgt
ttcgaaaacaagcataatgtcaaactcggctttatgtcgtttttcgtcaaggcctccatc
gaagcattgaaacgtttcccggccatcaacgcctccatcgacggtaacgacattatttat
cacggctattacgacattggtatcgccgtcaccaccccgcgcggcctgatcgtgcccatt
ttacgcgacgccgatcaattggacttcgccggcatcgaaaaaggcatacacgatttcggc
agcaaggcccgcaacggctctatcagtgttgaagacttgagcggaggcacgtttaccatc
accaacggcggtattttcggctccatgttgtccacgcccatcctcaatccgccgcaatgc
gccatcctcggcatgcatgccatcaaggacagaccggtggtcgaggacggccaaatagtg
attcgccccatcatgtatctggccttgtcctacgaccatcgcttggtagacggtaaggag
gcggtgcagtttttaggcattgttaaagaatgtctggaatcgccagcccatctgctactg
aacatctaa

DBGET integrated database retrieval system