KEGG   Methylomonas methanica: Metme_1899Help
Entry
Metme_1899        CDS       T01511                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmt  Methylomonas methanica
Pathway
mmt00020  Citrate cycle (TCA cycle)
mmt00310  Lysine degradation
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01120  Microbial metabolism in diverse environments
mmt01130  Biosynthesis of antibiotics
mmt01200  Carbon metabolism
Module
mmt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metme_1899
  Amino acid metabolism
   00310 Lysine degradation
    Metme_1899
Enzymes [BR:mmt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Metme_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_3 RnfC_N HTH_17 Hep_59
Motif
Other DBs
NCBI-ProteinID: AEG00315
JGI: Metme_1899
UniProt: G0A499
Position
complement(2079965..2081173)
Genome map
AA seq 402 aa AA seqDB search
MSFDILVPSLPESVSDATLVAWHKQPGDWVEAGDNLADLETDKVILEVPAPSSGVVTEII
RPAGETVVGGELLARLDLQKQNPASATTEPAEKSSTTTHTEEPPLSPSVRKLVAENEIDP
SGISGSGKHGRILKTDVLDYLNEQQAAQEDPAATSEASHNPLSATAVASLRPEQRVPMTR
MRAKIAERLLQAQQNAAMLTTFNEVDLSAVIELRNQYKERFENKHNVKLGFMSFFVKASI
EALKRFPAINASIDGNDIIYHGYYDIGIAVTTPRGLIVPILRDADQLDFAGIEKGIHDFG
SKARNGSISVEDLSGGTFTITNGGIFGSMLSTPILNPPQCAILGMHAIKDRPVVEDGQIV
IRPIMYLALSYDHRLVDGKEAVQFLGIVKECLESPAHLLLNI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgacattctggttcccagtctccccgaatccgtgtccgacgccactttggtg
gcttggcacaaacaacccggcgactgggtggaggcaggcgacaatctggctgaccttgaa
accgacaaggtgattttggaagttcccgcgccgtccagcggcgtggtcactgaaattatc
cgccctgcgggcgaaaccgtggtgggcggcgaattactggccagactggacctacagaag
caaaaccccgcgtccgcaaccactgaaccagccgaaaagtcctccactaccactcacacc
gaagagccgcctttaagcccgtcggtgcgcaaactggtagcggaaaacgaaatcgaccca
tccggcattagcggttccggcaaacacggacggattttaaaaaccgacgtattggattat
ttaaacgagcaacaagccgcgcaggaagatccggccgcgacatccgaagccagccacaac
ccgctatccgctaccgccgtcgccagtttgcggcctgaacaacgcgtaccgatgacccgc
atgcgggccaaaattgccgagcgtttgctgcaggcgcaacaaaatgcggccatgctgacc
acattcaacgaagtcgacctgtcggccgtgattgaattacgcaatcaatataaggagcgt
ttcgaaaacaagcataatgtcaaactcggctttatgtcgtttttcgtcaaggcctccatc
gaagcattgaaacgtttcccggccatcaacgcctccatcgacggtaacgacattatttat
cacggctattacgacattggtatcgccgtcaccaccccgcgcggcctgatcgtgcccatt
ttacgcgacgccgatcaattggacttcgccggcatcgaaaaaggcatacacgatttcggc
agcaaggcccgcaacggctctatcagtgttgaagacttgagcggaggcacgtttaccatc
accaacggcggtattttcggctccatgttgtccacgcccatcctcaatccgccgcaatgc
gccatcctcggcatgcatgccatcaaggacagaccggtggtcgaggacggccaaatagtg
attcgccccatcatgtatctggccttgtcctacgaccatcgcttggtagacggtaaggag
gcggtgcagtttttaggcattgttaaagaatgtctggaatcgccagcccatctgctactg
aacatctaa

DBGET integrated database retrieval system