KEGG   Methylomonas methanica: Metme_2399Help
Entry
Metme_2399        CDS       T01511                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmt  Methylomonas methanica
Pathway
mmt00010  Glycolysis / Gluconeogenesis
mmt00620  Pyruvate metabolism
mmt00640  Propanoate metabolism
mmt00680  Methane metabolism
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01120  Microbial metabolism in diverse environments
mmt01130  Biosynthesis of antibiotics
mmt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metme_2399
   00620 Pyruvate metabolism
    Metme_2399
   00640 Propanoate metabolism
    Metme_2399
  Energy metabolism
   00680 Methane metabolism
    Metme_2399
Enzymes [BR:mmt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Metme_2399
Lipid biosynthesis proteins [BR:mmt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Metme_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEG00799
JGI: Metme_2399
UniProt: F9ZVZ5
Position
2621226..2623163
Genome map
AA seq 645 aa AA seqDB search
MSEHHIYPVKPEIAAMAHIDAARYQRLYQQSINDPEGFWAEQARQFLDWAQPWQQVMKCD
FPTGDIHWFMGGKLNVSVNCLDRHLDTRGDQVAIIWEGDHPDYDDTLTYRELHSEVCKFA
NVLKAQGVKKGDRVCIYLPMISEAAVVILACTRIGAVHSIVFGGFSADALRDRILDADCR
YLICADESFRGGKIVPAKINADKAAAQCPNLHTIIVIKHTGHTIPWTEGRDVCYREAMAN
ASDDCPPEIMDAEDPLFILYTSGSTGQPKGVMHTTGGYLLYAAMTHKYVFDYQDGDVYWC
TADIGWITGHSYVLYGPLCNGATTLMFEGVPTYPAADRFWQVVDKHQVNIFYTAPTAIRA
LMAQGDDYVTRTNRSSLRILGSVGEPINPEAWEWYYHVVGEARCPIVDTWWQTETGGILI
TPLPGATDLKPGSATLPFFGIKPALVDNDGRLLEGVAEGNLVITASWPGQMRSVYGDHDR
FIETYFKKFPGLYFAGDGARRDEQGYYWITGRVDDVINVSGHRLGTAEIESALVLHHDVA
EAAVVGFPHAIKGQGIYAYVTLNAGVEPTDELKKQLKELIKEEISAIALPDFIQWAPGLP
KTRSGKIMRRILRKIAANDISSLGDTSTLADPAVVDDLLAQRAQQ
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacatcacatttatccagtcaagcccgaaattgccgccatggcgcatatcgat
gcggctcgctatcaacgcttgtatcagcaatcgattaacgatccggaaggcttttgggcc
gagcaggcccggcaatttctggattgggcgcaaccctggcaacaggtcatgaaatgcgat
tttcctaccggcgacatacattggtttatgggcggcaaactgaatgtaagcgtcaactgc
ctggatagacacctggatacgcgcggcgaccaagtggcgatcatttgggagggcgatcac
ccggattatgatgacacgctaacctatcgcgagttacacagcgaagtctgcaaatttgcc
aacgtgctgaaagcccaaggcgtgaaaaaaggcgaccgggtatgcatttatctgcccatg
atcagcgaagcggcggtggtgattctggcctgcacccgcattggcgcggtgcattccatt
gtgttcggcggtttttcggcggacgccctacgcgaccggattctggacgccgactgccgg
tatttgatttgcgccgacgaaagtttccggggcggcaaaatcgttccggccaaaatcaac
gccgacaaagccgccgcgcaatgccctaatttgcacactatcatcgtcatcaaacacacc
ggccacaccattccctggaccgaaggccgtgatgtctgctaccgcgaagccatggccaat
gcgtccgatgattgtccgccggaaataatggatgcggaagatccgttgttcattctgtat
acctccggttctaccggtcaacccaaaggcgtcatgcacaccacgggcggttacctgctg
tacgccgccatgacccacaaatatgtgttcgactatcaggatggcgacgtatattggtgt
accgccgacatcggctggatcaccggccattcttatgtgctttacggccctttatgtaac
ggtgccactaccttgatgttcgaaggcgtacccacctacccggctgcagaccggttttgg
caggtggtcgacaaacaccaagtgaatatattttatacggcaccgacggcgatacgggcc
ttgatggcgcaaggcgacgactacgtgacccgcaccaaccgcagcagcctgcgcatcctg
ggtagcgttggcgagccgattaacccggaggcctgggaatggtattaccatgtagtcggc
gaggcgcgttgccccattgtcgacacttggtggcaaaccgaaaccggcggaattctgatt
acgccattgccgggggcaaccgacttaaaaccgggttccgcaaccttgccttttttcggc
atcaaaccggcgctggtcgacaacgacggccgactgctggaaggcgtggccgaaggcaat
ctggtcatcaccgcatcctggcctggacaaatgcgctcggtttacggcgatcatgaccgc
tttatcgaaacctatttcaaaaaatttcccggcctttacttcgccggcgacggtgcccgc
cgcgatgaacagggctactactggatcaccggtcgggtggacgacgtgatcaatgtttcc
ggccatcgtctggggaccgcggaaatcgagagcgccctggttttacatcatgacgtggcc
gaagcggccgtggtgggcttcccccatgcgatcaaaggccagggtatttatgcgtatgtg
acgctcaatgccggcgtagaaccgacggatgaattaaaaaaacaactgaaggaattgatc
aaggaagagatcagcgccattgccctgccggatttcattcaatgggcgcccggtttgccg
aaaacccgttccggcaaaatcatgcggcgcattttgcgcaaaatcgccgccaacgatatc
agcagcttgggcgatacgtccacgctggcggatccggctgtagtcgacgatttgctggct
caacgcgcccagcaataa

DBGET integrated database retrieval system