KEGG   Methylomonas methanica: Metme_2399Help
Entry
Metme_2399        CDS       T01511                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmt  Methylomonas methanica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metme_2399
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metme_2399
   00620 Pyruvate metabolism
    Metme_2399
   00640 Propanoate metabolism
    Metme_2399
  Energy metabolism
   00680 Methane metabolism
    Metme_2399
Enzymes [BR:mmt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Metme_2399
Lipid biosynthesis proteins [BR:mmt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Metme_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2621226..2623163
Genome map
AA seq 645 aa AA seqDB search
MSEHHIYPVKPEIAAMAHIDAARYQRLYQQSINDPEGFWAEQARQFLDWAQPWQQVMKCD
FPTGDIHWFMGGKLNVSVNCLDRHLDTRGDQVAIIWEGDHPDYDDTLTYRELHSEVCKFA
NVLKAQGVKKGDRVCIYLPMISEAAVVILACTRIGAVHSIVFGGFSADALRDRILDADCR
YLICADESFRGGKIVPAKINADKAAAQCPNLHTIIVIKHTGHTIPWTEGRDVCYREAMAN
ASDDCPPEIMDAEDPLFILYTSGSTGQPKGVMHTTGGYLLYAAMTHKYVFDYQDGDVYWC
TADIGWITGHSYVLYGPLCNGATTLMFEGVPTYPAADRFWQVVDKHQVNIFYTAPTAIRA
LMAQGDDYVTRTNRSSLRILGSVGEPINPEAWEWYYHVVGEARCPIVDTWWQTETGGILI
TPLPGATDLKPGSATLPFFGIKPALVDNDGRLLEGVAEGNLVITASWPGQMRSVYGDHDR
FIETYFKKFPGLYFAGDGARRDEQGYYWITGRVDDVINVSGHRLGTAEIESALVLHHDVA
EAAVVGFPHAIKGQGIYAYVTLNAGVEPTDELKKQLKELIKEEISAIALPDFIQWAPGLP
KTRSGKIMRRILRKIAANDISSLGDTSTLADPAVVDDLLAQRAQQ
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacatcacatttatccagtcaagcccgaaattgccgccatggcgcatatcgat
gcggctcgctatcaacgcttgtatcagcaatcgattaacgatccggaaggcttttgggcc
gagcaggcccggcaatttctggattgggcgcaaccctggcaacaggtcatgaaatgcgat
tttcctaccggcgacatacattggtttatgggcggcaaactgaatgtaagcgtcaactgc
ctggatagacacctggatacgcgcggcgaccaagtggcgatcatttgggagggcgatcac
ccggattatgatgacacgctaacctatcgcgagttacacagcgaagtctgcaaatttgcc
aacgtgctgaaagcccaaggcgtgaaaaaaggcgaccgggtatgcatttatctgcccatg
atcagcgaagcggcggtggtgattctggcctgcacccgcattggcgcggtgcattccatt
gtgttcggcggtttttcggcggacgccctacgcgaccggattctggacgccgactgccgg
tatttgatttgcgccgacgaaagtttccggggcggcaaaatcgttccggccaaaatcaac
gccgacaaagccgccgcgcaatgccctaatttgcacactatcatcgtcatcaaacacacc
ggccacaccattccctggaccgaaggccgtgatgtctgctaccgcgaagccatggccaat
gcgtccgatgattgtccgccggaaataatggatgcggaagatccgttgttcattctgtat
acctccggttctaccggtcaacccaaaggcgtcatgcacaccacgggcggttacctgctg
tacgccgccatgacccacaaatatgtgttcgactatcaggatggcgacgtatattggtgt
accgccgacatcggctggatcaccggccattcttatgtgctttacggccctttatgtaac
ggtgccactaccttgatgttcgaaggcgtacccacctacccggctgcagaccggttttgg
caggtggtcgacaaacaccaagtgaatatattttatacggcaccgacggcgatacgggcc
ttgatggcgcaaggcgacgactacgtgacccgcaccaaccgcagcagcctgcgcatcctg
ggtagcgttggcgagccgattaacccggaggcctgggaatggtattaccatgtagtcggc
gaggcgcgttgccccattgtcgacacttggtggcaaaccgaaaccggcggaattctgatt
acgccattgccgggggcaaccgacttaaaaccgggttccgcaaccttgccttttttcggc
atcaaaccggcgctggtcgacaacgacggccgactgctggaaggcgtggccgaaggcaat
ctggtcatcaccgcatcctggcctggacaaatgcgctcggtttacggcgatcatgaccgc
tttatcgaaacctatttcaaaaaatttcccggcctttacttcgccggcgacggtgcccgc
cgcgatgaacagggctactactggatcaccggtcgggtggacgacgtgatcaatgtttcc
ggccatcgtctggggaccgcggaaatcgagagcgccctggttttacatcatgacgtggcc
gaagcggccgtggtgggcttcccccatgcgatcaaaggccagggtatttatgcgtatgtg
acgctcaatgccggcgtagaaccgacggatgaattaaaaaaacaactgaaggaattgatc
aaggaagagatcagcgccattgccctgccggatttcattcaatgggcgcccggtttgccg
aaaacccgttccggcaaaatcatgcggcgcattttgcgcaaaatcgccgccaacgatatc
agcagcttgggcgatacgtccacgctggcggatccggctgtagtcgacgatttgctggct
caacgcgcccagcaataa

DBGET integrated database retrieval system