KEGG   Methylomonas methanica: Metme_2656Help
Entry
Metme_2656        CDS       T01511                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mmt  Methylomonas methanica
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Metme_2656
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Metme_2656
Enzymes [BR:mmt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Metme_2656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2931710..2932261)
Genome map
AA seq 183 aa AA seqDB search
MQVTQLSIPDVILFTPKVFGDERGFFYESFNQSLFEALTGLNPQFVQDNHSKSQRGVLRG
LHYQLPPKGQGKLVRVVQGEVFDVAVDIRRGSPTFGQWVGVNLSAENKQQMWIPVGFAHG
FLTLSDTAEFLYKTTDYYSPEHERCILWNDADIGVQWPTDIVMPQLSGKDQHGKAFSVAE
LYD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaacgcaactgtcaattcccgatgtgattttgtttacgcctaaagtgtttggc
gatgaacgcgggtttttttacgagagttttaatcagtcgctgttcgaggcgttgacgggg
cttaatccgcaatttgtacaggataatcattccaagtcgcagcggggtgttctgcgcggc
ttgcactaccagttgccgccaaaaggtcaaggcaagctggtcagggtggtgcaaggcgag
gtattcgacgtggctgtggatattcgcagaggttcgcccaccttcggtcaatgggtgggt
gtcaatttatcggcggaaaacaaacaacaaatgtggataccggttggctttgcgcatggt
ttcctgacattatcggatacagcggaatttctgtataaaactaccgattattattcgccc
gagcacgaacgctgtatcttgtggaatgatgctgacatcggcgtacagtggcctacagat
atagtaatgccgcaactatccggtaaggatcagcacggtaaagcattttccgttgcggaa
ctgtacgactga

DBGET integrated database retrieval system