KEGG   Methylomonas methanica: Metme_2726Help
Entry
Metme_2726        CDS       T01511                                 

Definition
(GenBank) Sucrose phosphorylase
  KO
K00690  sucrose phosphorylase [EC:2.4.1.7]
Organism
mmt  Methylomonas methanica
Pathway
mmt00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Metme_2726
Enzymes [BR:mmt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Metme_2726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AEG01110
JGI: Metme_2726
UniProt: F9ZZ84
Position
3012015..3013793
Genome map
AA seq 592 aa AA seqDB search
MKPTTEHLASLTQKVVHHLESIYASAPRQPDSAALADTLLRIMRLDEHCEQLQPSNSAWS
ERDIAVITYGDTLLADSEAPLSTLHRFLNAYLHDTINTVHILPFFPFCSDDGFAVIDYYQ
VNPKLGDWPHIQALAADYRLMADLVINHCSTSSTWFQNFINGRGYGHDYFYTASPNTNLS
DVVRPRTSPLLRETETANGTQYVWCTFSHEQADLDFGNTAVLQEFVKIIRHYLDNGVRIF
RLDAVAFLWKKLGTNCLNLPETHEVVRLIRTLIEHSCADAVIITETNLPNRENLSYFGNG
NEAHSIYNFSLPPLLLNTLVTGNCRYLKQWLMSMPPAQNGTFYFNFIASHDGIGLRPAEG
LLSEAEIASLISTMQQFGGQVSWRSGDNGTKRPYEINIALFDALQGTTKGKDAFGIERFV
CAHAIMLALEGIPAFYMHSLLATGNDYPRFESTGQNRAINRHQWDYPSLTAALNDAQNHH
HQVFERLKALVRIRQQQPAFHPNATQFTLHISDQLFGFWRQSMDRRQSIFCIYNVSDEPH
SLLLSNLNLIVTDDWRDLISGQRYDDPMMDRIDIAPYQTLWITNRHVTEQAV
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccaccacggaacacttggcctcgttaactcaaaaagtcgtacaccatctcgaa
tcgatttacgcgtccgcgccgcgccaaccggacagtgcggcgctggccgacacgctgtta
aggatcatgcgcctagacgagcattgcgaacagttgcaaccctcgaatagcgcctggtcc
gaacgcgatatagcggtgattacatacggcgacacgcttctcgccgacagcgaagccccc
ctaagcaccctgcatcggttcttaaacgcctatctgcacgacaccatcaacacggtacac
attctgccgtttttcccgttttgttccgacgacggcttcgcggtaatcgactattaccaa
gtcaatccaaaactgggcgactggccgcacattcaagcccttgccgcagactatcggctg
atggccgacttggtgatcaaccattgttccaccagcagcacttggttccaaaacttcatc
aacggccgaggttacggccacgactatttttataccgcttcgccgaataccaatctgtcc
gatgtcgtcaggccgcgcacctcgccgttactccgcgaaaccgaaaccgccaacggcact
caatatgtctggtgcacattcagccacgaacaggccgacctggacttcggcaataccgcc
gtgctgcaagagttcgtcaaaatcatccgccattatctggataacggtgttcgcatcttt
cgtctggatgcggtggcatttttatggaaaaaacttggcacaaactgcctgaatctgccc
gaaacccatgaagtggtgcggctgattcgcacgctgatcgaacatagttgcgcagatgcc
gtcatcatcaccgaaaccaacctgccgaaccgggaaaacctcagttatttcggcaacggc
aacgaggcgcacagtatttataacttctcgttgccgccgctattgctgaacaccctggtc
accggcaactgccgttacctgaaacaatggttgatgagcatgccgcctgcacaaaacggt
accttctattttaacttcatcgcctcccacgacggcatcggcctgcgcccggcagaaggc
ctgcttagcgaagcggaaatcgcctcgctgatcagcaccatgcagcaatttggcgggcag
gtatcctggcgtagcggcgataacggtaccaaacggccgtatgaaatcaacatcgccctg
ttcgacgccttgcaaggcacgaccaagggcaaggacgcattcggcatcgagcgctttgtc
tgcgcgcacgcgattatgctggccttggaaggcataccggcgttttatatgcatagcctg
ctggccaccggcaacgattacccacgcttcgaaagcaccggtcaaaaccgcgccatcaac
cgccatcaatgggactacccaagcctgaccgccgccttgaacgatgcgcaaaaccaccat
catcaagtcttcgaacggctgaaagcgctggtccgcattcggcagcaacagccggccttt
caccccaacgctactcaattcaccctgcacatcagcgaccagttattcggtttttggcgg
cagagcatggatcgcagacagagtatattctgcatctacaatgtcagcgacgagccccat
tcattactgctgtccaacctgaacttgatcgtcaccgacgactggcgggatctgatcagc
ggccagcgctacgacgaccccatgatggacaggatcgatatcgcaccgtatcagacgtta
tggattaccaatcgacacgtgaccgagcaagcggtttga

DBGET integrated database retrieval system