KEGG   Methylomonas methanica: Metme_2837Help
Entry
Metme_2837        CDS       T01511                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mmt  Methylomonas methanica
Pathway
mmt00260  Glycine, serine and threonine metabolism
mmt00750  Vitamin B6 metabolism
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01120  Microbial metabolism in diverse environments
mmt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metme_2837
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metme_2837
Enzymes [BR:mmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metme_2837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEG01218
JGI: Metme_2837
UniProt: G0A079
Position
complement(3138966..3140060)
Genome map
AA seq 364 aa AA seqDB search
MATQQRYTGLIERYRDRLPVSADTRLISLCEGNTPLIRLENIPRLIGKDVDIYVKFEGLN
PTGSFKDRGMTMAVTKAVEEGSQAIICASTGNTSASAAAYAVRAGIKAFVLIPEGKIALG
KLAQTLMYGAQIIQINGNFDAGMNIVKQIADHAPVAIVNSINPFRLQGQKTAAFEIIDEL
GGAPDYHCLPVGNAGNISAYWMGYTEYAQDLPGLPAVADKRPIMCGYQAAGAAPFVAGKM
IDHPETVATAIRIGHPQSWDLAWNAQKESGGWFDSQTDQQILAAQKMLSQYEGVFCEPAS
AASLAGALQDIGSGKIPEGSRIVCTLTGNGIKDPDIAISQCKDAHPVTIEANLDAVKKAI
LDSM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaacaacgctacaccggcttgatcgagcgctaccgcgaccgcttgccggtc
tccgccgacacccgattgatcagcttgtgcgaaggtaacacgccgctgatccgcttggag
aacatcccgcgcctgatcggtaaggatgtggatatatatgtgaaattcgagggtttgaat
ccgaccggttcctttaaagatcgcggtatgaccatggccgtcaccaaagcggtggaagag
ggcagtcaagccatcatctgcgcctctacaggtaatacttcagcctcggctgctgcctat
gcggtgcgtgccggtatcaaagccttcgtgctgattccggaaggtaaaatcgccttgggc
aaattagcgcaaaccctgatgtacggcgcgcaaatcattcagatcaacggcaatttcgat
gccggcatgaatatcgtcaagcaaattgccgatcatgcgccggttgccatcgtcaactcc
atcaatcccttccgtctgcaagggcagaaaaccgccgccttcgaaattatcgacgaattg
ggcggtgcgccggactatcactgcttgccggtcggtaatgccggcaacatttccgcctat
tggatgggctataccgaatatgcgcaagacttgccgggtttgcctgccgtggccgacaaa
cgcccgatcatgtgcggctatcaagcagcgggtgcagcgccgttcgtggccggtaaaatg
atcgatcatcccgagaccgtggcgaccgccattcgtatcggccatccgcaatcctgggat
ttggcttggaatgcccaaaaagaatccggcggttggttcgattcgcaaaccgaccagcaa
attctggcggcgcaaaaaatgctgtcgcaatacgaaggcgtgttctgcgaaccggcttct
gcagcgtccttggccggtgccttgcaggatatcggttccggcaagattcccgagggcagc
cgcatagtctgtaccttgaccggcaacggcatcaaggatccggatatcgccatcagtcaa
tgcaaggatgcccatccggtcaccatagaagcgaatctggatgcggttaaaaaagctatt
ctggattcgatgtaa

DBGET integrated database retrieval system