KEGG   Methylomonas methanica: Metme_2837Help
Entry
Metme_2837        CDS       T01511                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmt  Methylomonas methanica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metme_2837
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metme_2837
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metme_2837
Enzymes [BR:mmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metme_2837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3138966..3140060)
Genome map
AA seq 364 aa AA seqDB search
MATQQRYTGLIERYRDRLPVSADTRLISLCEGNTPLIRLENIPRLIGKDVDIYVKFEGLN
PTGSFKDRGMTMAVTKAVEEGSQAIICASTGNTSASAAAYAVRAGIKAFVLIPEGKIALG
KLAQTLMYGAQIIQINGNFDAGMNIVKQIADHAPVAIVNSINPFRLQGQKTAAFEIIDEL
GGAPDYHCLPVGNAGNISAYWMGYTEYAQDLPGLPAVADKRPIMCGYQAAGAAPFVAGKM
IDHPETVATAIRIGHPQSWDLAWNAQKESGGWFDSQTDQQILAAQKMLSQYEGVFCEPAS
AASLAGALQDIGSGKIPEGSRIVCTLTGNGIKDPDIAISQCKDAHPVTIEANLDAVKKAI
LDSM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaacaacgctacaccggcttgatcgagcgctaccgcgaccgcttgccggtc
tccgccgacacccgattgatcagcttgtgcgaaggtaacacgccgctgatccgcttggag
aacatcccgcgcctgatcggtaaggatgtggatatatatgtgaaattcgagggtttgaat
ccgaccggttcctttaaagatcgcggtatgaccatggccgtcaccaaagcggtggaagag
ggcagtcaagccatcatctgcgcctctacaggtaatacttcagcctcggctgctgcctat
gcggtgcgtgccggtatcaaagccttcgtgctgattccggaaggtaaaatcgccttgggc
aaattagcgcaaaccctgatgtacggcgcgcaaatcattcagatcaacggcaatttcgat
gccggcatgaatatcgtcaagcaaattgccgatcatgcgccggttgccatcgtcaactcc
atcaatcccttccgtctgcaagggcagaaaaccgccgccttcgaaattatcgacgaattg
ggcggtgcgccggactatcactgcttgccggtcggtaatgccggcaacatttccgcctat
tggatgggctataccgaatatgcgcaagacttgccgggtttgcctgccgtggccgacaaa
cgcccgatcatgtgcggctatcaagcagcgggtgcagcgccgttcgtggccggtaaaatg
atcgatcatcccgagaccgtggcgaccgccattcgtatcggccatccgcaatcctgggat
ttggcttggaatgcccaaaaagaatccggcggttggttcgattcgcaaaccgaccagcaa
attctggcggcgcaaaaaatgctgtcgcaatacgaaggcgtgttctgcgaaccggcttct
gcagcgtccttggccggtgccttgcaggatatcggttccggcaagattcccgagggcagc
cgcatagtctgtaccttgaccggcaacggcatcaaggatccggatatcgccatcagtcaa
tgcaaggatgcccatccggtcaccatagaagcgaatctggatgcggttaaaaaagctatt
ctggattcgatgtaa

DBGET integrated database retrieval system