KEGG   Methylomonas methanica: Metme_3199Help
Entry
Metme_3199        CDS       T01511                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mmt  Methylomonas methanica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Metme_3199
DNA repair and recombination proteins [BR:mmt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Metme_3199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3528055..3528651)
Genome map
AA seq 198 aa AA seqDB search
MQNAGLLKELIQSLCCLPGVGPKSAQRMAFHLLQRNRDGGRQLSLVLAQAMDKIGYCRDC
RTLTETEVCEICANRLREDDLLCVVESAADVWVIDQATSFKGKYFVLHGRLSPLDGIGPD
ELGIDKLEQRLAGGAIKEIILATNSTIEGQATAHFIGEIANKFNIRATRIAHGVPMGGEL
EFIDSGTLAHAFAGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgcgggtttgctgaaagaactgattcaaagcctgtgttgtttgccgggcgtg
ggccccaaatcggctcagcgcatggcgtttcatttattgcagcgcaatcgcgacggcggt
cggcaactgagtctggtattggcgcaagccatggacaagataggctattgccgggattgc
cgtactttgaccgaaaccgaagtttgcgagatatgcgctaaccgattgcgcgaggacgac
ctgctgtgcgtggtggaaagcgccgccgatgtctgggtcatcgatcaggccaccagtttt
aaaggcaaatatttcgtgttgcacggccgtttgtcgccgctggacggtatcggtcccgac
gaactgggcatcgacaagttggagcaacgcttggccggcggcgccataaaagaaatcatt
ctggccaccaattccaccatagaaggtcaagccaccgcgcatttcatcggcgaaatcgcc
aacaaattcaacattcgcgccacccgcatcgcccacggggtaccgatgggcggcgagttg
gagttcatcgacagcggtaccttggcgcatgcctttgccggccggcgcgaggtttaa

DBGET integrated database retrieval system