KEGG   Methylomonas methanica: Metme_3325Help
Entry
Metme_3325        CDS       T01511                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mmt  Methylomonas methanica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metme_3325
   00030 Pentose phosphate pathway
    Metme_3325
   00051 Fructose and mannose metabolism
    Metme_3325
   00052 Galactose metabolism
    Metme_3325
   00500 Starch and sucrose metabolism
    Metme_3325
   00520 Amino sugar and nucleotide sugar metabolism
    Metme_3325
  Nucleotide metabolism
   00230 Purine metabolism
    Metme_3325
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Metme_3325
Enzymes [BR:mmt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Metme_3325
    5.4.2.8  phosphomannomutase
     Metme_3325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3662071..3664701
Genome map
AA seq 876 aa AA seqDB search
MGRIFSIIAAISALMVFIAGIGTYWFAAADAKTTKKAAAALVANNLAASLGMQLSTLQAT
VDGLAQTPDVIAALSSGNPDVIQATAAKLQTVIPHTLRLRLLPPNISDLDQSQTPHMGYG
DLEMVQATLTGKPQPVIQGDAEHRHLAVTSAVRNGEQVVGVILASLKPDLLQQLVTKTPF
DNGLIELKQDQLVLATIGQPTNRNDDPTSIAVGNSRWQLNAWANFDTSLADIGILTGLIG
IPALMACLAFFIGYRKFSEFFRHDQSGILNAAKDMLQGKSMGSYPMQLDEMQPIIAAMVQ
FKRVMDQEDSPLLNGDRNSAYDLFDESFDIDFLEESQPAAADPVQAVPITTSAIPVSMPD
FEKVSEYKPDSDSSLLDSALDDSGFDTTSDIESWDMPSSSASVQPATSQPSDFAGKTQST
ATSIFRNREIRGIVGQNIDEATIATIGRAIASEARQLNINTIVVGRDGRSSSPALSEALI
KGITSTGCDVLDIGLIPTPVLYFVSHHSEGRTGIMVTGSHYPPDQNGLKIVLNGEPLSAE
LIHALQSRIAQQNFVQDPTGAIDRNTLFSNEYIGIISEDTHIVRPMTIVVDSGNGATGEL
GPMLLKGIGCDVVELNCDIDGRFPSHQPDPGNPANLEALIKAVKLNNADAGIAFDGDGDR
MALVDSSGRIIWADRLLMLFARDVLAIKPGSEIIYDTACSSHLPEQIKKRGGYPVLCKHG
TAALQSRLRETGAALAGDLSGHFLFNDRWFGFNDPLYAAVRIIELLSADMRSSSELFDDL
PESVSTPELHVALAEGESLHFMEQVFSQAQFADGDIVNVDGMRVEFADGWGLVRASDTSA
DLALRFEANSLEALSRIQQQFKLLLLQINPEISLPF
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtattttcagcattattgctgcgatttcggcattaatggtgtttattgccgga
atcggcacctactggtttgcggccgccgacgcgaaaaccaccaaaaaagccgccgccgca
ctggtcgccaacaatctggccgcgagtctcggcatgcagttgagtaccctgcaggcaaca
gtggatggcttggcccaaaccccggatgtgatagccgctttaagttcgggcaatccggat
gttattcaggcaacagcggcgaagctgcaaaccgttatacctcataccctgcgactacgc
ttactcccgcccaatattagcgacctggatcaatcgcaaacgccgcatatgggatatggc
gatctggagatggtgcaagccaccttaaccggcaagccgcaaccagtgatacaaggcgat
gccgaacatcgccacttggcagtaaccagcgccgttcggaacggcgaacaagtcgtgggc
gttattttagcaagcctaaaacccgatttattgcaacagctggttaccaagactccgttc
gacaacggcctgatcgagctaaaacaagatcaactggtgctggcaacgatcggccaaccc
accaatcgaaatgacgaccctacttccattgccgtcggcaacagccgttggcaactaaac
gcctgggcgaatttcgataccagcttggccgatatcggtattctgaccggtctgatcggc
attcctgccttgatggcatgcttggcgttttttatcggctatcgtaaatttagcgaattc
ttccgccacgatcaaagcggcattttaaacgccgcgaaggatatgctgcagggcaagagt
atgggcagttatccgatgcagctcgacgaaatgcaacccatcatcgccgcgatggtgcaa
tttaagcgcgtgatggatcaggaagactcgccactactgaatggcgatagaaattcagct
tacgacttgtttgacgagtctttcgatatcgactttctggaagaatcccagcccgccgcg
gcagacccggtgcaagccgtacccatcaccacttcagcgatacccgtgtcgatgccggat
ttcgaaaaagtatctgaatataaacctgatagcgattcatccctgctggatagcgctttg
gatgattccggcttcgacacaacctccgacatagaaagctgggacatgccttcgtcttcc
gcatcggttcaaccggcgaccagccagccaagcgattttgcgggcaagacgcaatcaaca
gccacatcgattttccgcaaccgtgaaatcagaggcatcgtcggccaaaacatcgatgaa
gcgaccatcgcgactattggtcgcgccattgccagtgaagccagacaactcaacatcaat
accattgtagtcggcagagacggacgcagctccagccccgctttaagcgaagccttaatc
aaaggcattacctctaccggttgcgatgtcctggatatcggcttgattcccacacccgtg
ttatattttgtcagtcaccatagcgagggccggaccggtatcatggtgacaggcagccac
tacccccccgatcaaaacgggttaaagattgtattgaatggtgaaccgctgtccgccgaa
ctcattcacgcccttcaatcccgtatcgcccaacaaaatttcgttcaagaccctacgggt
gccatagaccgcaacaccttattcagtaacgaatatatcggcatcatttccgaagacacc
cacatcgtgcgccccatgaccatagtcgtcgacagcggcaatggcgctaccggcgaactg
ggccccatgctgctgaaaggcataggttgcgatgtggtcgaacttaattgcgacatagac
ggccgattccccagtcatcaacccgatcccggcaaccccgccaacctggaagccttgatc
aaggcggtgaaactgaataatgccgatgccggcattgcctttgacggcgatggcgaccgc
atggcattagtcgactccagcgggcggatcatctgggcggaccggctgttgatgttgttt
gcccgcgacgtattggcaatcaaacccggctcggaaattatttacgataccgcctgctcc
agccatttgccggaacaaatcaaaaaacgcggcggatatccggttttatgcaagcacggt
acggcggcactgcaaagccgtttaagggaaacaggtgcggccctggccggcgacctgagc
ggtcatttcctgttcaatgaccgctggttcggttttaacgacccgctttatgctgcggtg
cgcatcatagaactgctttccgccgacatgcgctccagcagcgaattgttcgacgacctg
cccgagagtgtcagcacgcctgaattacatgtcgcgcttgccgaaggcgaaagcctccat
tttatggaacaggtattcagtcaggcccaatttgccgacggcgacattgtcaatgtggac
ggcatgcgcgtcgagtttgccgatggctggggactggtcagggcttccgacacatcggca
gacctggcattacgatttgaggccaacagcctcgaagcgttaagccgcatccagcaacag
tttaaactgttgctgctgcaaattaacccagagatttctcttcccttttaa

DBGET integrated database retrieval system