KEGG   Methylomonas methanica: Metme_3389Help
Entry
Metme_3389        CDS       T01511                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mmt  Methylomonas methanica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3735252..3736286
Genome map
AA seq 344 aa AA seqDB search
MQKNSSSIKSSTDILKQAIQFIGQHNITAIPINYTVSYEYCRGHHVLLRQAIDQAIVNKQ
PITNEAIQGWFDAFLLGYDLSELNKSHLDLNNIVDQLASTTTQAEEDVNQYDTSLKECKD
ELNETLDTSSLSSIVSSLLTSTTAMQIAMEQMKQQITASQCEIASLQDRLALVTIEAVTD
PLTGLANRKGLSMAINESLSTALQSKNYPCLLLLDIDYFKKINDSFGHLVGDKAIKILAD
TLKKQLKGKDTAARYGGEEFAILLPETDLQNAWKVGENIRRVVESLRITRSNNHEEVFRM
TISIGIARYQANQSINDLIELADNALYQSKNTGRNRVTIFETKL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaatagctcgtcaatcaagtccagcacagacatcctaaagcaagcgatacaa
tttatcggccagcacaacattactgcgatacctataaactacacagtaagttacgaatat
tgtcgtggtcatcacgttctattacgacaagcaattgatcaggccatcgtaaataagcaa
ccgatcactaatgaagcgattcagggttggtttgacgcttttttgctcggttatgattta
agtgaattaaataaatcgcatttagacctgaataacatcgtcgatcaattggcatcaaca
accacccaggctgaagaagatgtcaaccagtacgatacgtcgttgaaagagtgtaaagac
gaattaaatgagaccttagatacatcatcgctctcgtcgattgtttcatcgttgcttacc
agcaccactgcgatgcagattgcgatggaacaaatgaaacagcaaattaccgccagtcag
tgcgaaatcgcttcgttacaagatcgtttagccttggtaactatagaagccgtaacagac
ccattgacaggtttagccaatcgaaaaggcttatcgatggctatcaacgaatcgttgagt
actgcgcttcaatcaaaaaattatccttgtctactgttgttggatatcgattattttaaa
aaaataaacgatagtttcggtcatttggtcggcgataaagccataaaaatattagcagat
acgttaaagaaacagctcaaaggcaaggataccgcggcgcgttacggcggtgaagagttt
gcaattttgctgccagaaactgacctacaaaatgcttggaaagttggagaaaatattcgg
cgggttgttgagagcttgaggatcaccaggagcaacaatcatgaggaagtttttcgtatg
accatttccattggcatagcccgctatcaagctaatcaaagcattaacgacttgatcgaa
ctggcagacaatgcgctgtatcaatccaaaaacacagggcgcaaccgagtcactatcttc
gagacaaaactttag

DBGET integrated database retrieval system